TPTP Axioms File: CSR002+3.ax


%------------------------------------------------------------------------------
% File     : CSR002+3 : TPTP v7.5.0. Released v3.4.0.
% Domain   : Common Sense Reasoning
% Axioms   : 44216 axioms from Cyc
% Version  : Especial.
% English  :

% Refs     : [RS+]   Reagan Smith et al., The Cyc TPTP Challenge Problem
% Source   : [RS+]
% Names    :

% Status   : Satisfiable
% Syntax   : Number of formulae    : 44216 (23808 unit)
%            Number of atoms       : 65453 (   8 equality)
%            Maximal formula depth :    8 (   2 average)
%            Number of connectives : 21419 ( 182 ~  ;   0  |; 913  &)
%                                         (   0 <=>;20324 =>;   0 <=)
%                                         (   0 <~>;   0 ~|;   0 ~&)
%            Number of predicates  : 6814 (   0 propositional; 1-6 arity)
%            Number of functors    : 15051 (14712 constant; 0-4 arity)
%            Number of variables   : 24045 (   0 singleton;24045 !;   0 ?)
%            Maximal term depth    :    6 (   1 average)
% SPC      : 

% Comments : Autogenerated from the OpenCyc KB. Documentation can be found at
%            http://opencyc.org/doc/#TPTP_Challenge_Problem_Set
%          : Cyc(R) Knowledge Base Copyright(C) 1995-2007 Cycorp, Inc., Austin,
%            TX, USA. All rights reserved.
%          : OpenCyc Knowledge Base Copyright(C) 2001-2007 Cycorp, Inc.,
%            Austin, TX, USA. All rights reserved.
%          : A superset of CSR002+0.ax CSR002+1.ax CSR002+2
%          : It is known that there are some duplicate axioms.
%------------------------------------------------------------------------------
% Cyc Assertion #528036:
fof(ax3_1,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_timblairspleenvillecomarchives007948php)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2171974:
fof(ax3_2,axiom,(
    genlmt(c_tptp_member260_mt,c_basekb) )).

% Cyc Assertion #2437177:
fof(ax3_3,axiom,
    ( mtvisible(c_tptp_member131_mt)
   => tptpofobject(f_instancewithrelationtofn(c_airport_physical,c_airporthasiatacode,s_tlh),f_tptpquantityfn_14(n_23)) )).

% Cyc Assertion #1665245:
fof(ax3_4,axiom,(
    genls(c_leader,c_partiallytangible) )).

fof(ax3_5,axiom,(
    ! [OBJ] :
      ( leader(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2171722:
fof(ax3_6,axiom,(
    genlmt(c_tptp_member197_mt,c_basekb) )).

% Cyc Assertion #1042711:
fof(ax3_7,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfwsgovendangerediasaa8dhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #477384:
fof(ax3_8,axiom,(
    genlmt(c_needsoelexicalmt,c_basekb) )).

% Cyc Assertion #765110:
fof(ax3_9,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmesothelioma__attorneycomstatenew_yorkhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1571034:
fof(ax3_10,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_edutourstocubacomcustomizedethicscubasyllabus2002htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #160409:
fof(ax3_11,axiom,(
    genls(c_puppet,c_artifact) )).

fof(ax3_12,axiom,(
    ! [OBJ] :
      ( puppet(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #2183030:
fof(ax3_13,axiom,(
    genlmt(c_tptp_member3024_mt,c_basekb) )).

% Cyc Assertion #391009:
fof(ax3_14,axiom,(
    genls(c_ruinedartifact,c_artifact) )).

fof(ax3_15,axiom,(
    ! [OBJ] :
      ( ruinedartifact(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #515481:
fof(ax3_16,axiom,(
    genlmt(c_productphysicalcharacteristicsvocabularymt,c_basekb) )).

% Cyc Assertion #2171078:
fof(ax3_17,axiom,(
    genlmt(c_tptp_member36_mt,c_basekb) )).

% Cyc Assertion #2180786:
fof(ax3_18,axiom,(
    genlmt(c_tptp_member2463_mt,c_basekb) )).

% Cyc Assertion #1623660:
fof(ax3_19,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archivestcmiebreakingnews20030903story112045asp)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1581081:
fof(ax3_20,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_goat))
     => partiallytangible(OBJ) ) )).

fof(ax3_21,axiom,(
    genls(f_groupfn(c_goat),c_partiallytangible) )).

fof(ax3_22,axiom,(
    ! [OBJ] :
      ( groupfngoat(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #972434:
fof(ax3_23,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_videobarnesandnoblecomsearchbiographyaspctr215408)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1761793:
fof(ax3_24,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwajrorgarticle_printableaspid750)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #377535:
fof(ax3_25,axiom,(
    genls(c_cruisemissile_agm84eharpoon,c_individual) )).

fof(ax3_26,axiom,(
    ! [OBJ] :
      ( cruisemissile_agm84eharpoon(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1318818:
fof(ax3_27,axiom,(
    genls(c_nationalwildandscenicriver_blm_nps_usfs,c_partiallytangible) )).

fof(ax3_28,axiom,(
    ! [OBJ] :
      ( nationalwildandscenicriver_blm_nps_usfs(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1500190:
fof(ax3_29,axiom,(
    genlmt(f_symmetryneutralizedmtfn(c_femalehumanbodystructuremt),c_basekb) )).

% Cyc Assertion #738485:
fof(ax3_30,axiom,(
    genlmt(c_spanishlexicalmt,c_basekb) )).

% Cyc Assertion #145306:
fof(ax3_31,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_30),c_basekb) )).

% Cyc Assertion #1101082:
fof(ax3_32,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwallwebdirectoriescomwwlanew_york_city_asbestos_attorney_informationhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #221797:
fof(ax3_33,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecomforumtmaspm62284mpage2)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1213966:
fof(ax3_34,axiom,(
    genls(c_kbcontenttestforaquaintkbpiloteval_fromlcc_m,c_individual) )).

fof(ax3_35,axiom,(
    ! [OBJ] :
      ( kbcontenttestforaquaintkbpiloteval_fromlcc_m(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2463162:
fof(ax3_36,axiom,(
    genlmt(c_tptpgeo_member7_mt,c_tptpgeo_spindleheadmt) )).

% Cyc Assertion #1058134:
fof(ax3_37,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www2usenetarchiveorgdir100file477html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2492975:
fof(ax3_38,axiom,
    ( mtvisible(c_tptpgeo_member3_mt)
   => geographicalsubregions(c_georegion_l3_x4_y13,c_georegion_l4_x13_y40) )).

% Cyc Assertion #1047182:
fof(ax3_39,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmilechaicomjudaismrabbi_meir_kahanehtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1246001:
fof(ax3_40,axiom,(
    genls(c_missilesystem_m67,c_individual) )).

fof(ax3_41,axiom,(
    ! [OBJ] :
      ( missilesystem_m67(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2171382:
fof(ax3_42,axiom,(
    genlmt(c_tptp_member112_mt,c_basekb) )).

% Cyc Assertion #1802470:
fof(ax3_43,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordozoffset0)),c_translation_32),c_basekb) )).

% Cyc Assertion #2179438:
fof(ax3_44,axiom,(
    genlmt(c_tptp_member2126_mt,c_basekb) )).

% Cyc Assertion #314079:
fof(ax3_45,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_22),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1437867:
fof(ax3_46,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpbsorgwnetamericanmastersdylanindex12html)),c_translation_33),c_basekb) )).

% Cyc Assertion #1560056:
fof(ax3_47,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),f_glassboxallotmentfn(s_e7dff3f0_099f_412b_bd76_51c9b4a540a7),c_nooescape_theprogram),c_nooescapearchitecturemt) )).

% Cyc Assertion #797357:
fof(ax3_48,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwc_spanstoreorgshopindexphpmain_pageproduct_video_infocpath18_22products_id165364_1)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1889962:
fof(ax3_49,axiom,(
    genls(c_tptpcol_11_26887,c_tptpcol_10_26886) )).

fof(ax3_50,axiom,(
    ! [OBJ] :
      ( tptpcol_11_26887(OBJ)
     => tptpcol_10_26886(OBJ) ) )).

% Cyc Assertion #2246811:
fof(ax3_51,axiom,(
    executionbyfiringsquad(c_tptpexecutionbyfiringsquad_90) )).

% Cyc Assertion #510321:
fof(ax3_52,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wildcatarizonaedupapers911407_1_mhtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #2182530:
fof(ax3_53,axiom,(
    genlmt(c_tptp_member2899_mt,c_basekb) )).

% Cyc Assertion #908998:
fof(ax3_54,axiom,(
    genls(c_abominablesnowman,c_individual) )).

fof(ax3_55,axiom,(
    ! [OBJ] :
      ( abominablesnowman(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #241018:
fof(ax3_56,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwiueduusersmfwcwiugreatgatsbyhtml)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1056281:
fof(ax3_57,axiom,(
    genlmt(c_domesticbreedsvocabularymt,c_basekb) )).

% Cyc Assertion #242943:
fof(ax3_58,axiom,(
    genls(c_microscopicscaleobject,c_partiallytangible) )).

fof(ax3_59,axiom,(
    ! [OBJ] :
      ( microscopicscaleobject(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #895923:
fof(ax3_60,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cbinicintjun02htm)),c_translation_0),c_basekb) )).

% Cyc Assertion #844695:
fof(ax3_61,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthestudentroomcoukshowthreadphpt111657page7)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1755266:
fof(ax3_62,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwradfordreviewscomcgi_binrviewcgirmmode2typereviewnameamistad)),c_translation_27),c_basekb) )).

% Cyc Assertion #394701:
fof(ax3_63,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_militaryperson,c_hasmembers,c_governmentmilitaryorganization))
     => militaryperson(OBJ) ) )).

fof(ax3_64,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_militaryperson,c_hasmembers,c_governmentmilitaryorganization),c_militaryperson) )).

fof(ax3_65,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnmilitarypersonhasmembersgovernmentmilitaryorganization(OBJ)
     => militaryperson(OBJ) ) )).

% Cyc Assertion #1054119:
fof(ax3_66,axiom,(
    genlmt(c_horuslocusplusontologymappingmt,c_basekb) )).

% Cyc Assertion #884579:
fof(ax3_67,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwanswerscomtopictechnical_university_of_munich)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1730723:
fof(ax3_68,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplecchristiedougftppypeoplecchristiedougcanadaright)),c_translation_3),c_basekb) )).

% Cyc Assertion #615910:
fof(ax3_69,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newssurfwaxcommoviesfilespretty_woman_moviehtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #746447:
fof(ax3_70,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_diagonallyorgforumviewtopicphpp98891sid30402306706f8b17405a36ee5f5f6846)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1471090:
fof(ax3_71,axiom,(
    genlmt(c_bravo_infoconlevelmt,c_basekb) )).

% Cyc Assertion #2171594:
fof(ax3_72,axiom,(
    genlmt(c_tptp_member165_mt,c_basekb) )).

% Cyc Assertion #2171834:
fof(ax3_73,axiom,(
    genlmt(c_tptp_member225_mt,c_basekb) )).

% Cyc Assertion #1425385:
fof(ax3_74,axiom,(
    genlmt(c_corpuslexicalmt,c_basekb) )).

% Cyc Assertion #2181270:
fof(ax3_75,axiom,(
    genlmt(c_tptp_member2584_mt,c_basekb) )).

% Cyc Assertion #1626183:
fof(ax3_76,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #231187:
fof(ax3_77,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcresourceiorgbiblestudybb1cor2html)),c_translation_32),c_basekb) )).

% Cyc Assertion #662982:
fof(ax3_78,axiom,(
    genlmt(c_coabs_rwpreconditionsmt,c_basekb) )).

% Cyc Assertion #2264656:
fof(ax3_79,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => isa(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_7402,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)) )).

fof(ax3_80,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => subcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_7402) )).

% Cyc Assertion #487610:
fof(ax3_81,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1197678:
fof(ax3_82,axiom,(
    genlmt(c_naturalismmt,c_basekb) )).

% Cyc Assertion #2182702:
fof(ax3_83,axiom,(
    genlmt(c_tptp_member2942_mt,c_basekb) )).

% Cyc Assertion #1373490:
fof(ax3_84,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeorgiamonthlycomfestivaloftreeshtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1011145:
fof(ax3_85,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_filmguardiancoukfeature_storyobserver041202538500html)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2170932:
fof(ax3_86,axiom,(
    genlmt(c_tptp_spindleheadmt,c_cyclistsmt) )).

% Cyc Assertion #1636979:
fof(ax3_87,axiom,(
    genlmt(c_uia_personalassistant_demoenvironmentmt,c_basekb) )).

% Cyc Assertion #1294235:
fof(ax3_88,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_iceland))
     => individual(OBJ) ) )).

fof(ax3_89,axiom,(
    genls(f_residentfn(c_iceland),c_individual) )).

fof(ax3_90,axiom,(
    ! [OBJ] :
      ( residentfniceland(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2180410:
fof(ax3_91,axiom,(
    genlmt(c_tptp_member2369_mt,c_basekb) )).

% Cyc Assertion #2173526:
fof(ax3_92,axiom,(
    genlmt(c_tptp_member648_mt,c_basekb) )).

% Cyc Assertion #2468270:
fof(ax3_93,axiom,(
    individual(c_georegion_l4_x52_y60) )).

% Cyc Assertion #1658271:
fof(ax3_94,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordarnoldschwarzeneggeroffset0)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #235285:
fof(ax3_95,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_30),c_basekb) )).

% Cyc Assertion #139826:
fof(ax3_96,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1070436:
fof(ax3_97,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #944542:
fof(ax3_98,axiom,(
    genlmt(c_cyclishparaphrasemt,c_basekb) )).

% Cyc Assertion #1497711:
fof(ax3_99,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom2005_08_01_visionsofparadise_archivehtml)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2463158:
fof(ax3_100,axiom,(
    genlmt(c_tptpgeo_member6_mt,c_tptpgeo_spindleheadmt) )).

% Cyc Assertion #800612:
fof(ax3_101,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomhowardhawks)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1678804:
fof(ax3_102,axiom,(
    genlmt(c_olympicsdatamt,c_basekb) )).

% Cyc Assertion #520992:
fof(ax3_103,axiom,(
    genls(c_nlquery,c_individual) )).

fof(ax3_104,axiom,(
    ! [OBJ] :
      ( nlquery(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #813023:
fof(ax3_105,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmesothelioma__attorneycomstatenew_yorkhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2090373:
fof(ax3_106,axiom,(
    firstordercollection(c_tptpcol_15_107053) )).

% Cyc Assertion #148260:
fof(ax3_107,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_the_cruciblebiographyms)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #357301:
fof(ax3_108,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmccchurchorgmncstatement20of20call20to20be20the20next20moderator20of20ufmccdoc)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2481764:
fof(ax3_109,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x47_y17) )).

% Cyc Assertion #2171014:
fof(ax3_110,axiom,(
    genlmt(c_tptp_member20_mt,c_basekb) )).

% Cyc Assertion #1082963:
fof(ax3_111,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwneverarycomn1n1umbrellahtm)),c_translation_8),c_basekb) )).

% Cyc Assertion #2174654:
fof(ax3_112,axiom,(
    genlmt(c_tptp_member930_mt,c_basekb) )).

% Cyc Assertion #570029:
fof(ax3_113,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_formaldehyde,c_partiallytangible) )).

fof(ax3_114,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & formaldehyde(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1802937:
fof(ax3_115,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwradfordreviewscomcgi_binrviewcgirmmode2typereviewnameamistad)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1056315:
fof(ax3_116,axiom,(
    genls(c_ve_nerveagent,c_partiallytangible) )).

fof(ax3_117,axiom,(
    ! [OBJ] :
      ( ve_nerveagent(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #910658:
fof(ax3_118,axiom,(
    genls(c_coverlimitingterrain,c_geographicalregion) )).

fof(ax3_119,axiom,(
    ! [OBJ] :
      ( coverlimitingterrain(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #769062:
fof(ax3_120,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_roadsidegeorgiacomtoursgone_with_the_windhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183122:
fof(ax3_121,axiom,(
    genlmt(c_tptp_member3047_mt,c_basekb) )).

% Cyc Assertion #826406:
fof(ax3_122,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_17),c_basekb) )).

% Cyc Assertion #498143:
fof(ax3_123,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwminneapolisparksorgdocumentscaringwirth_minnha_mgmt_plan1pdf)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1658081:
fof(ax3_124,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),c_researchfailediranrussianucleardeal,c_nooescape_theprogram),c_nooescapearchitecturemt) )).

% Cyc Assertion #1744770:
fof(ax3_125,axiom,(
    genls(c_organization_topic,c_thing) )).

fof(ax3_126,axiom,(
    ! [OBJ] :
      ( organization_topic(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1762410:
fof(ax3_127,axiom,(
    genls(c_semtranslexiconspecification,c_individual) )).

fof(ax3_128,axiom,(
    ! [OBJ] :
      ( semtranslexiconspecification(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1452314:
fof(ax3_129,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_12),c_machinelearningspindleheadmt) )).

% Cyc Assertion #332770:
fof(ax3_130,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomscrewball20comedy20film)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1555255:
fof(ax3_131,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_chloroethane,c_partiallytangible) )).

fof(ax3_132,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & chloroethane(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2185150:
fof(ax3_133,axiom,(
    genlmt(c_tptp_member3554_mt,c_basekb) )).

% Cyc Assertion #519700:
fof(ax3_134,axiom,(
    genls(c_navalinvasion,c_individual) )).

fof(ax3_135,axiom,(
    ! [OBJ] :
      ( navalinvasion(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1244269:
fof(ax3_136,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_attitudethemercurynewscomaucheese_batmanbalehtm)),c_translation_0),c_basekb) )).

% Cyc Assertion #2174382:
fof(ax3_137,axiom,(
    genlmt(c_tptp_member862_mt,c_basekb) )).

% Cyc Assertion #343961:
fof(ax3_138,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwourbigcountrycomparticlesmi_m1346is_4_46ai_72610303)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173666:
fof(ax3_139,axiom,(
    genlmt(c_tptp_member683_mt,c_basekb) )).

% Cyc Assertion #1745140:
fof(ax3_140,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_28),c_basekb) )).

% Cyc Assertion #572725:
fof(ax3_141,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_evaluatingvalueofwithrespecttofn(c_database_physical,c_missionspecificationmicrotheory))
     => individual(OBJ) ) )).

fof(ax3_142,axiom,(
    genls(f_evaluatingvalueofwithrespecttofn(c_database_physical,c_missionspecificationmicrotheory),c_individual) )).

fof(ax3_143,axiom,(
    ! [OBJ] :
      ( evaluatingvalueofwithrespecttofndatabase_physicalmissionspecificationmicrotheory(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #587201:
fof(ax3_144,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #606528:
fof(ax3_145,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhookhackcomflytiershintshtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2180834:
fof(ax3_146,axiom,(
    genlmt(c_tptp_member2475_mt,c_basekb) )).

% Cyc Assertion #936513:
fof(ax3_147,axiom,
    ( mtvisible(c_modernwesternmedicinemt)
   => keclarifyingcollectiontype(f_drugtherapyusefn(c_insulinthesecretion)) )).

% Cyc Assertion #1425551:
fof(ax3_148,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjohnsonposterscom)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2467643:
fof(ax3_149,axiom,(
    individual(c_georegion_l4_x45_y0) )).

% Cyc Assertion #531664:
fof(ax3_150,axiom,(
    genlmt(c_informationgvocabularymt,c_basekb) )).

% Cyc Assertion #1358688:
fof(ax3_151,axiom,(
    genlmt(c_militaryforcestructuremt,c_basekb) )).

% Cyc Assertion #1498369:
fof(ax3_152,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_the_cruciblebiographyms)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #339196:
fof(ax3_153,axiom,(
    genlmt(c_cycapimt,c_basekb) )).

% Cyc Assertion #1803607:
fof(ax3_154,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtiscalicoukreferenceencyclopaediahutchinsonm0001993html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #181293:
fof(ax3_155,axiom,(
    genlmt(f_contentmtfn(c_nationalatlas_ks),c_basekb) )).

% Cyc Assertion #393336:
fof(ax3_156,axiom,(
    genlmt(c_mtafterhormuzblocking,c_basekb) )).

% Cyc Assertion #1099519:
fof(ax3_157,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_19),c_basekb) )).

% Cyc Assertion #858468:
fof(ax3_158,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjohnlithgowoffset0)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2314538:
fof(ax3_159,axiom,(
    genlmt(c_theprototypicalbpvi_checkpointmicrotheory,c_basekb) )).

% Cyc Assertion #2183507:
fof(ax3_160,axiom,(
    genlmt(c_tptp_member3143_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #2180938:
fof(ax3_161,axiom,(
    genlmt(c_tptp_member2501_mt,c_basekb) )).

% Cyc Assertion #897188:
fof(ax3_162,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_11),c_basekb) )).

% Cyc Assertion #1291276:
fof(ax3_163,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_zenasecureforumcomznetzmagarticlesmartinezjume98htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1469673:
fof(ax3_164,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwcgorglitlawwhatlawhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #369499:
fof(ax3_165,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #496201:
fof(ax3_166,axiom,(
    genlmt(c_gafgatheringlogmt,c_basekb) )).

% Cyc Assertion #902135:
fof(ax3_167,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetcollectorroadalternateroute(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #899293:
fof(ax3_168,axiom,(
    genlmt(c_reportkmt,c_basekb) )).

% Cyc Assertion #1644968:
fof(ax3_169,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwxcapewithuscomhot_dealshotels_in_city_of_andorra_la_vellahotel_salviaasp)),c_translation_33),c_basekb) )).

% Cyc Assertion #1438319:
fof(ax3_170,axiom,(
    genls(c_peacekeeper,c_militaryperson) )).

fof(ax3_171,axiom,(
    ! [OBJ] :
      ( peacekeeper(OBJ)
     => militaryperson(OBJ) ) )).

% Cyc Assertion #2181059:
fof(ax3_172,axiom,(
    genlmt(c_tptp_member2531_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #682994:
fof(ax3_173,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadalive_whtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #667086:
fof(ax3_174,axiom,(
    genlmt(c_socreport_fbi_20030408_reportcontent,c_basekb) )).

% Cyc Assertion #2181322:
fof(ax3_175,axiom,(
    genlmt(c_tptp_member2597_mt,c_basekb) )).

% Cyc Assertion #1342232:
fof(ax3_176,axiom,(
    genlmt(f_contextofpcwfn(c_modernuslegalcode),c_basekb) )).

% Cyc Assertion #195846:
fof(ax3_177,axiom,(
    genlmt(c_saicalqaidadatamt,c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #2175762:
fof(ax3_178,axiom,(
    genlmt(c_tptp_member1207_mt,c_basekb) )).

% Cyc Assertion #1386360:
fof(ax3_179,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(f_urlfn(s_http_www3sympaticocajohnfktonyr2html)))) )).

% Cyc Assertion #1040315:
fof(ax3_180,axiom,(
    arg2isa(c_many_genquantrelnfromtype,c_setorcollection) )).

fof(ax3_181,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( many_genquantrelnfromtype(ARG1,ARG2,ARG3)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #388807:
fof(ax3_182,axiom,(
    genlmt(c_pq201mt,c_basekb) )).

% Cyc Assertion #1519609:
fof(ax3_183,axiom,(
    genls(c_stateroute_primary,c_partiallytangible) )).

fof(ax3_184,axiom,(
    ! [OBJ] :
      ( stateroute_primary(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2178134:
fof(ax3_185,axiom,(
    genlmt(c_tptp_member1800_mt,c_basekb) )).

% Cyc Assertion #1043014:
fof(ax3_186,axiom,(
    genlmt(c_worldenergydatabasemt,c_hpkbvocabmt) )).

% Cyc Assertion #1486006:
fof(ax3_187,axiom,(
    genls(c_puffy,c_partiallytangible) )).

fof(ax3_188,axiom,(
    ! [OBJ] :
      ( puffy(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2053402:
fof(ax3_189,axiom,(
    genls(c_tptpcol_14_92264,c_tptpcol_13_92263) )).

fof(ax3_190,axiom,(
    ! [OBJ] :
      ( tptpcol_14_92264(OBJ)
     => tptpcol_13_92263(OBJ) ) )).

% Cyc Assertion #1636944:
fof(ax3_191,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcwrueduartscienglmarlinghardboiledothermediahtm)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #2180518:
fof(ax3_192,axiom,(
    genlmt(c_tptp_member2396_mt,c_basekb) )).

% Cyc Assertion #1202166:
fof(ax3_193,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmedicdirectcoukclinicsdefaultihtmlstep4pid132)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2171506:
fof(ax3_194,axiom,(
    genlmt(c_tptp_member143_mt,c_basekb) )).

% Cyc Assertion #1594129:
fof(ax3_195,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_drycreekbed))
     => partiallytangible(OBJ) ) )).

fof(ax3_196,axiom,(
    genls(f_groupfn(c_drycreekbed),c_partiallytangible) )).

fof(ax3_197,axiom,(
    ! [OBJ] :
      ( groupfndrycreekbed(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1688625:
fof(ax3_198,axiom,(
    genls(c_biologicalattacktypebytargettype,c_collection) )).

fof(ax3_199,axiom,(
    ! [OBJ] :
      ( biologicalattacktypebytargettype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1457214:
fof(ax3_200,axiom,(
    genlmt(c_wamt_modevalinitial_p2,c_basekb) )).

% Cyc Assertion #931193:
fof(ax3_201,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_14),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1223104:
fof(ax3_202,axiom,(
    genls(c_placingavisibleindicatoronanobject,c_individual) )).

fof(ax3_203,axiom,(
    ! [OBJ] :
      ( placingavisibleindicatoronanobject(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #185981:
fof(ax3_204,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpvponlinecomnewsproarchivesarc7_2003html)),c_translation_26),c_basekb) )).

% Cyc Assertion #203080:
fof(ax3_205,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwequiporgfreedd229htm)),c_translation_0),c_basekb) )).

% Cyc Assertion #625107:
fof(ax3_206,axiom,(
    genlmt(c_internationalenergyoutlook1997mt,c_basekb) )).

% Cyc Assertion #2173146:
fof(ax3_207,axiom,(
    genlmt(c_tptp_member553_mt,c_basekb) )).

% Cyc Assertion #448070:
fof(ax3_208,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadianwestern_guard_partyftppyorgscanadianwestern_guard_partycanadaright)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1356115:
fof(ax3_209,axiom,(
    genlmt(f_contentmtfn(c_testwesternregion_fht),c_basekb) )).

% Cyc Assertion #188739:
fof(ax3_210,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmuslimhopecombibleanswerstthtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #432233:
fof(ax3_211,axiom,(
    genlmt(c_planetarygeographymt,c_basekb) )).

% Cyc Assertion #1045828:
fof(ax3_212,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcfsanfdagovfrfforum02a006j1htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1326548:
fof(ax3_213,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwavontyrescomusensafetytiresafetyinstructionsasp)),c_translation_30),c_basekb) )).

% Cyc Assertion #199497:
fof(ax3_214,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecoukforumtmaspm62284mpage5)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2328561:
fof(ax3_215,axiom,
    ( mtvisible(c_tptp_member1717_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_977) )).

% Cyc Assertion #371772:
fof(ax3_216,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_storecoolstampscomendeavorsearchs_c332modestart80max20extcat)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1512742:
fof(ax3_217,axiom,(
    genlmt(c_reasoningwithagency_logicmt,c_basekb) )).

% Cyc Assertion #465735:
fof(ax3_218,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombthesettlementofmoraginthesouthernpartofthegazastrip,c_actiononobject,s_33f82ff3_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_219,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombthesettlementofmoraginthesouthernpartofthegazastrip,c_actiononobject,s_33f82ff3_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_220,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarybombthesettlementofmoraginthesouthernpartofthegazastripactiononobject33f82ff3_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #622671:
fof(ax3_221,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_medeasmedialistsblueblogchcinema)),c_translation_31),c_basekb) )).

% Cyc Assertion #1026823:
fof(ax3_222,axiom,(
    genlmt(c_radiologicalattackidentificationtestmt,c_basekb) )).

% Cyc Assertion #681017:
fof(ax3_223,axiom,(
    genlmt(c_terroristfinancedatabasesourcemt,c_basekb) )).

% Cyc Assertion #1672026:
fof(ax3_224,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordmoonstruckoffset0)),c_translation_31),c_basekb) )).

% Cyc Assertion #1385892:
fof(ax3_225,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_mihtm)),c_translation_14),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1281750:
fof(ax3_226,axiom,(
    genlmt(c_planforzolfaghar2,c_basekb) )).

% Cyc Assertion #1127808:
fof(ax3_227,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtherealoceancitycomgetting_to_ocean_cityhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #622992:
fof(ax3_228,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweyeneteyeissueissue_092001funnytwinshtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #1479860:
fof(ax3_229,axiom,(
    genls(c_toolset,c_artifact) )).

fof(ax3_230,axiom,(
    ! [OBJ] :
      ( toolset(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1066493:
fof(ax3_231,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_11),c_basekb) )).

% Cyc Assertion #924628:
fof(ax3_232,axiom,(
    genls(c_aerodromeconcept,c_thing) )).

fof(ax3_233,axiom,(
    ! [OBJ] :
      ( aerodromeconcept(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1264630:
fof(ax3_234,axiom,(
    genlmt(c_simplebackingstoreschematranslationmt,c_basekb) )).

% Cyc Assertion #1684749:
fof(ax3_235,axiom,(
    genlmt(c_weathermt,c_basekb) )).

% Cyc Assertion #734450:
fof(ax3_236,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_diagonallyorgforumviewtopicphpp98891sid30402306706f8b17405a36ee5f5f6846)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #211947:
fof(ax3_237,axiom,(
    genlmt(c_worldnaturalgeographymt,c_basekb) )).

% Cyc Assertion #747279:
fof(ax3_238,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2463169:
fof(ax3_239,axiom,(
    genls(c_geolevel_0,c_geographicalregion) )).

fof(ax3_240,axiom,(
    ! [OBJ] :
      ( geolevel_0(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #2174950:
fof(ax3_241,axiom,(
    genlmt(c_tptp_member1004_mt,c_basekb) )).

% Cyc Assertion #2180070:
fof(ax3_242,axiom,(
    genlmt(c_tptp_member2284_mt,c_basekb) )).

% Cyc Assertion #846039:
fof(ax3_243,axiom,(
    genlmt(c_ckbfactentrytemplatesmt,c_basekb) )).

% Cyc Assertion #877117:
fof(ax3_244,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_accessoryfn_activity(f_playingfn(c_badminton)))
     => artifact(OBJ) ) )).

fof(ax3_245,axiom,(
    genls(f_accessoryfn_activity(f_playingfn(c_badminton)),c_artifact) )).

fof(ax3_246,axiom,(
    ! [OBJ] :
      ( accessoryfn_activityplayingfnbadminton(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1728098:
fof(ax3_247,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwanswerscomtopicsewanee_the_university_of_the_south)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #796229:
fof(ax3_248,axiom,(
    genlmt(c_reasoningwithtense_logicmt_lineardiscretetime,c_basekb) )).

% Cyc Assertion #1346266:
fof(ax3_249,axiom,(
    genls(c_intangibleexistingthing,c_intangibleindividual) )).

fof(ax3_250,axiom,(
    ! [OBJ] :
      ( intangibleexistingthing(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #457082:
fof(ax3_251,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamericanveterannewspaperorgavn_nreleasehtm)),c_translation_0),c_basekb) )).

% Cyc Assertion #2188844:
fof(ax3_252,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_tptp_member654_mt)
        & isa(TERM,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )
     => tptp_9_28(TERM,f_relationallexistsfn(TERM,c_tptp_9_28,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_24756)) ) )).

fof(ax3_253,axiom,
    ( mtvisible(c_tptp_member654_mt)
   => relationallexists(c_tptp_9_28,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_24756) )).

% Cyc Assertion #2186642:
fof(ax3_254,axiom,(
    genlmt(c_tptp_member3927_mt,c_basekb) )).

% Cyc Assertion #1114363:
fof(ax3_255,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cantonrepositorycomtopfivephpvote5headlineflashbacksid201497category20)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1714300:
fof(ax3_256,axiom,(
    genls(c_cuesta,c_partiallytangible) )).

fof(ax3_257,axiom,(
    ! [OBJ] :
      ( cuesta(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #534146:
fof(ax3_258,axiom,
    ( mtvisible(c_ciaworldfactbook1995mt)
   => genls(c_copper,c_partiallytangible) )).

fof(ax3_259,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_ciaworldfactbook1995mt)
        & copper(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1267996:
fof(ax3_260,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordhitsoffset0)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1547926:
fof(ax3_261,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetabandoned_existentialstatushumanresidence(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #161552:
fof(ax3_262,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dailyhaggiscomindexphp200402page2)),c_translation_31),c_basekb) )).

% Cyc Assertion #2185522:
fof(ax3_263,axiom,(
    genlmt(c_tptp_member3647_mt,c_basekb) )).

% Cyc Assertion #2180750:
fof(ax3_264,axiom,(
    genlmt(c_tptp_member2454_mt,c_basekb) )).

% Cyc Assertion #950538:
fof(ax3_265,axiom,(
    genlmt(f_contextofpcwfn(c_wearclothesinpublic),c_humansociallifemt) )).

% Cyc Assertion #631445:
fof(ax3_266,axiom,(
    genlmt(c_worldgeographymt,c_geographymt) )).

% Cyc Assertion #1185865:
fof(ax3_267,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2203417:
fof(ax3_268,axiom,
    ( mtvisible(c_tptp_spindleheadmt)
   => isa(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_42,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)) )).

fof(ax3_269,axiom,
    ( mtvisible(c_tptp_spindleheadmt)
   => subcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_42) )).

% Cyc Assertion #1311825:
fof(ax3_270,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfacultysfasuedupunpsycho_log014page3htm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185538:
fof(ax3_271,axiom,(
    genlmt(c_tptp_member3651_mt,c_basekb) )).

% Cyc Assertion #770061:
fof(ax3_272,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwallstarzorgkevinbaconbiohtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #940061:
fof(ax3_273,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordolympiaoffset0)),c_translation_33),c_basekb) )).

% Cyc Assertion #1346873:
fof(ax3_274,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikilance_guest)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #181732:
fof(ax3_275,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom2005_07_01_cycledog_archivehtml)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #547051:
fof(ax3_276,axiom,(
    genlmt(c_factsheetquerycontextindexical,c_basekb) )).

% Cyc Assertion #428200:
fof(ax3_277,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadiannorthern_foundationcanadaright)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #336209:
fof(ax3_278,axiom,(
    genlmt(c_americanprofessionalsportsmt,c_ethnicgroupsmt) )).

% Cyc Assertion #1309766:
fof(ax3_279,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeorgiamonthlycomfestivaloftreeshtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2179810:
fof(ax3_280,axiom,(
    genlmt(c_tptp_member2219_mt,c_basekb) )).

% Cyc Assertion #882300:
fof(ax3_281,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_criticsocietycomreviewaspid1554)),c_translation_30),c_basekb) )).

% Cyc Assertion #537881:
fof(ax3_282,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkimmccallorgwritingspnhpnh_abstracthtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #446098:
fof(ax3_283,axiom,(
    genlmt(c_foodbuyinggmt,c_basekb) )).

% Cyc Assertion #1344370:
fof(ax3_284,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinformationblastcomtechnical_university_of_munichhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #1468043:
fof(ax3_285,axiom,(
    ! [OBJ] :
      ( collectiondefinedbyfnsublquotefncyc_subl_tv_p(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1419614:
fof(ax3_286,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordcheroffset0)),c_translation_33),c_basekb) )).

% Cyc Assertion #1511170:
fof(ax3_287,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_sutoorizari_municipalitymacedonia) )).

% Cyc Assertion #1019841:
fof(ax3_288,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_issue,c_topicofindividual,c_security_emotion))
     => individual(OBJ) ) )).

fof(ax3_289,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_issue,c_topicofindividual,c_security_emotion),c_individual) )).

fof(ax3_290,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnissuetopicofindividualsecurity_emotion(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1136396:
fof(ax3_291,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #368032:
fof(ax3_292,axiom,(
    genlmt(c_uiacommandtemplatemt,c_basekb) )).

% Cyc Assertion #929697:
fof(ax3_293,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enmimihustarsmatt_dillonhtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1155251:
fof(ax3_294,axiom,(
    genlmt(c_nonusprofessionalsportsmt,c_gregoriancalendarmt) )).

% Cyc Assertion #2176542:
fof(ax3_295,axiom,(
    genlmt(c_tptp_member1402_mt,c_basekb) )).

% Cyc Assertion #1353417:
fof(ax3_296,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineseatscomwill_smith_ticketsindexasp)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #472542:
fof(ax3_297,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_thing,c_preconditionfor_props,c_thing))
     => thing(OBJ) ) )).

fof(ax3_298,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_thing,c_preconditionfor_props,c_thing),c_thing) )).

fof(ax3_299,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnthingpreconditionfor_propsthing(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1789342:
fof(ax3_300,axiom,(
    genlmt(f_contextofpcwfn(c_faircreditbillingact),c_basekb) )).

% Cyc Assertion #1341162:
fof(ax3_301,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #1701708:
fof(ax3_302,axiom,(
    genlmt(c_newzealandenglishmt,c_basekb) )).

% Cyc Assertion #2177624:
fof(ax3_303,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member1672_mt) )).

% Cyc Assertion #1184743:
fof(ax3_304,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycombenhecht)),c_translation_31),c_basekb) )).

% Cyc Assertion #1118620:
fof(ax3_305,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_westernamericanablogspotcom200511tackling_new_frontier_in_filmhtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #481858:
fof(ax3_306,axiom,(
    genlmt(c_imsmowithmaxofxr_spp_datamt,c_basekb) )).

% Cyc Assertion #1779972:
fof(ax3_307,axiom,(
    genlmt(c_pq80_84mt,c_basekb) )).

% Cyc Assertion #2181154:
fof(ax3_308,axiom,(
    genlmt(c_tptp_member2555_mt,c_basekb) )).

% Cyc Assertion #504657:
fof(ax3_309,axiom,(
    genls(c_brdm_2,c_partiallytangible) )).

fof(ax3_310,axiom,(
    ! [OBJ] :
      ( brdm_2(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1592703:
fof(ax3_311,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_naivephysicsvocabularymt)
        & isa(OBJ,f_groupfn(c_freesheet)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_312,axiom,
    ( mtvisible(c_naivephysicsvocabularymt)
   => genls(f_groupfn(c_freesheet),c_partiallytangible) )).

fof(ax3_313,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_naivephysicsvocabularymt)
        & groupfnfreesheet(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1178902:
fof(ax3_314,axiom,(
    genlmt(f_contextofpcwfn(c_montgomerybussegregationlaw),c_humansociallifemt) )).

% Cyc Assertion #271943:
fof(ax3_315,axiom,(
    genlmt(c_unitedstateshistorymt,c_basekb) )).

% Cyc Assertion #456602:
fof(ax3_316,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhssenieedusgstaffkahackwomenhtm)),c_translation_13),c_basekb) )).

% Cyc Assertion #1822752:
fof(ax3_317,axiom,(
    genls(c_tptpcol_0_0,c_individual) )).

fof(ax3_318,axiom,(
    ! [OBJ] :
      ( tptpcol_0_0(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #577440:
fof(ax3_319,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwunityofanaheimorgccuprometheushtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2463752:
fof(ax3_320,axiom,(
    individual(c_georegion_l3_x17_y24) )).

% Cyc Assertion #2181794:
fof(ax3_321,axiom,(
    genlmt(c_tptp_member2715_mt,c_basekb) )).

% Cyc Assertion #1297506:
fof(ax3_322,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dmozorgartsmoviestitlesgdeschtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #711434:
fof(ax3_323,axiom,(
    genlmt(c_securitymt,c_basekb) )).

% Cyc Assertion #301913:
fof(ax3_324,axiom,(
    genls(c_informationneed,c_individual) )).

fof(ax3_325,axiom,(
    ! [OBJ] :
      ( informationneed(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1389205:
fof(ax3_326,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_6),c_basekb) )).

% Cyc Assertion #2176718:
fof(ax3_327,axiom,(
    genlmt(c_tptp_member1446_mt,c_basekb) )).

% Cyc Assertion #1353321:
fof(ax3_328,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwitvsorgoutsidelookinginfilmhtml)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1621763:
fof(ax3_329,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreenselectcoukvisitoreditorial562html)),c_translation_11),c_basekb) )).

% Cyc Assertion #852177:
fof(ax3_330,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_crossoverfollowingcomdigitalragehtml)),c_translation_30),c_basekb) )).

% Cyc Assertion #1731523:
fof(ax3_331,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1740252:
fof(ax3_332,axiom,(
    genlmt(c_materialsmanipulationmt,c_basekb) )).

% Cyc Assertion #567008:
fof(ax3_333,axiom,(
    genls(c_agents_topic,c_thing) )).

fof(ax3_334,axiom,(
    ! [OBJ] :
      ( agents_topic(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #863349:
fof(ax3_335,axiom,(
    genlmt(c_rightwingterrorismandweaponsofmassdestructionmt,c_organizationdatamt) )).

% Cyc Assertion #894332:
fof(ax3_336,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjohnlithgowoffset0)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2188349:
fof(ax3_337,axiom,
    ( mtvisible(c_tptp_member237_mt)
   => tptptypes_9_401(c_pushingababycarriage,c_tptpcol_16_10258) )).

% Cyc Assertion #2186394:
fof(ax3_338,axiom,(
    genlmt(c_tptp_member3865_mt,c_basekb) )).

% Cyc Assertion #2186898:
fof(ax3_339,axiom,(
    genlmt(c_tptp_member3991_mt,c_basekb) )).

% Cyc Assertion #1351014:
fof(ax3_340,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_26),c_basekb) )).

% Cyc Assertion #1209725:
fof(ax3_341,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archivestcmieirishexaminer20000826currentfpage_7htm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #384428:
fof(ax3_342,axiom,
    ( mtvisible(c_moss_battleforhue1968mt)
   => regiment_militaryechelon(c_arvn_3rdregiment) )).

% Cyc Assertion #2181634:
fof(ax3_343,axiom,(
    genlmt(c_tptp_member2675_mt,c_basekb) )).

% Cyc Assertion #1760421:
fof(ax3_344,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #876386:
fof(ax3_345,axiom,(
    genlmt(c_organicchemistrymt,c_basekb) )).

% Cyc Assertion #2184574:
fof(ax3_346,axiom,(
    genlmt(c_tptp_member3410_mt,c_basekb) )).

% Cyc Assertion #1310031:
fof(ax3_347,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfreerepubliccomfocusf_news1531919posts)),c_translation_28),c_basekb) )).

% Cyc Assertion #1446122:
fof(ax3_348,axiom,(
    genls(c_binarysimplevector,c_individual) )).

fof(ax3_349,axiom,(
    ! [OBJ] :
      ( binarysimplevector(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #963416:
fof(ax3_350,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentfilm3099234stm)),c_translation_31),c_basekb) )).

% Cyc Assertion #410720:
fof(ax3_351,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjerrylentzcomarchive2003_06_01_archivehtml)),c_translation_31),c_basekb) )).

% Cyc Assertion #2175034:
fof(ax3_352,axiom,(
    genlmt(c_tptp_member1025_mt,c_basekb) )).

% Cyc Assertion #2175834:
fof(ax3_353,axiom,(
    genlmt(c_tptp_member1225_mt,c_basekb) )).

% Cyc Assertion #508883:
fof(ax3_354,axiom,(
    genlmt(c_pq132mt,c_basekb) )).

% Cyc Assertion #2175378:
fof(ax3_355,axiom,(
    genlmt(c_tptp_member1111_mt,c_basekb) )).

% Cyc Assertion #1800804:
fof(ax3_356,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfredcampercomafilmby0009201html)),c_translation_33),c_basekb) )).

% Cyc Assertion #533198:
fof(ax3_357,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweonlinecomnewsitems011107000htmlibd)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #973185:
fof(ax3_358,axiom,(
    genls(c_bqdp3,c_partiallytangible) )).

fof(ax3_359,axiom,(
    ! [OBJ] :
      ( bqdp3(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1038305:
fof(ax3_360,axiom,(
    genls(c_formulatemplateassertionformat,c_individual) )).

fof(ax3_361,axiom,(
    ! [OBJ] :
      ( formulatemplateassertionformat(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #753114:
fof(ax3_362,axiom,(
    genlmt(c_insiderussiasnuclearcomplexmt,c_basekb) )).

% Cyc Assertion #1543802:
fof(ax3_363,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgreens_inorgarticle229phpsessid3641f5f711b0afdf34ae8268e87866d3)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2494563:
fof(ax3_364,axiom,
    ( mtvisible(c_tptpgeo_member1_mt)
   => geographicalsubregions(c_georegion_l3_x11_y2,c_georegion_l4_x33_y8) )).

% Cyc Assertion #2177026:
fof(ax3_365,axiom,(
    genlmt(c_tptp_member1523_mt,c_basekb) )).

% Cyc Assertion #1519482:
fof(ax3_366,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwuniversitysportcaestory_detailcfmid6284)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2225068:
fof(ax3_367,axiom,(
    individual(c_tptpinternational1924spheroid_8) )).

% Cyc Assertion #2183002:
fof(ax3_368,axiom,(
    genlmt(c_tptp_member3017_mt,c_basekb) )).

% Cyc Assertion #547140:
fof(ax3_369,axiom,(
    genls(c_durationofamonarchspower,c_individual) )).

fof(ax3_370,axiom,(
    ! [OBJ] :
      ( durationofamonarchspower(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #472430:
fof(ax3_371,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfanforumcomarchiveindexphpt_6083html)),c_translation_0),c_basekb) )).

% Cyc Assertion #382928:
fof(ax3_372,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwindependent_bangladeshcomnewsjul0101072005mghtm)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185722:
fof(ax3_373,axiom,(
    genlmt(c_tptp_member3697_mt,c_basekb) )).

% Cyc Assertion #440975:
fof(ax3_374,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwderbypsorgmusicnhso_03bernstein_wss_rtroophtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #146210:
fof(ax3_375,axiom,(
    genlmt(f_modelmtbyuserandtaskfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),c_allotment_9),c_basekb) )).

% Cyc Assertion #492091:
fof(ax3_376,axiom,(
    genlmt(c_javatoolsfeedbackmt,c_cyclistsmt) )).

% Cyc Assertion #1326245:
fof(ax3_377,axiom,(
    genlmt(c_corecyclmt,c_logicaltruthmt) )).

% Cyc Assertion #2186294:
fof(ax3_378,axiom,(
    genlmt(c_tptp_member3840_mt,c_basekb) )).

% Cyc Assertion #433737:
fof(ax3_379,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_jessicajosephs),c_genericintelligenceanalysis_cae_allotment,c_nooescape_theprogram),c_nooescapearchitecturemt) )).

% Cyc Assertion #166682:
fof(ax3_380,axiom,(
    arg2isa(c_few_genquantrelnfromtype,c_setorcollection) )).

fof(ax3_381,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( few_genquantrelnfromtype(ARG1,ARG2,ARG3)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #1777215:
fof(ax3_382,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthedailybulletincompostcardsmar9chtm)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #433990:
fof(ax3_383,axiom,(
    genls(c_methanesulfonylchloride,c_partiallytangible) )).

fof(ax3_384,axiom,(
    ! [OBJ] :
      ( methanesulfonylchloride(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #848803:
fof(ax3_385,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtvcomhome_improvementbackstage_passepisode23169summaryhtml)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #664158:
fof(ax3_386,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_communicationsuwocawestern_newsstoryhtmllisting_id16325)),c_translation_2),c_basekb) )).

% Cyc Assertion #1171515:
fof(ax3_387,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_21),c_basekb) )).

% Cyc Assertion #783963:
fof(ax3_388,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlivejournalcomgobmljournalpareviewitemid8422dirprev)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1007904:
fof(ax3_389,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfree_researchpaperscomdbsa3bqg32shtml)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #502151:
fof(ax3_390,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_26),c_basekb) )).

% Cyc Assertion #1050733:
fof(ax3_391,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_whatisthecapitalofcomstate_capitalsstate_capitals_tf1html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2182554:
fof(ax3_392,axiom,(
    genlmt(c_tptp_member2905_mt,c_basekb) )).

% Cyc Assertion #1197257:
fof(ax3_393,axiom,(
    genlmt(c_cyccanonicalguidmappingmt,c_basekb) )).

% Cyc Assertion #423844:
fof(ax3_394,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbalivisitorcomhotelsarea11_page2html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #684467:
fof(ax3_395,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfree_researchpaperscomdbsa3bqg32shtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176550:
fof(ax3_396,axiom,(
    genlmt(c_tptp_member1404_mt,c_basekb) )).

% Cyc Assertion #349764:
fof(ax3_397,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_https_fscimagefisherscicommsds56396htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1431016:
fof(ax3_398,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwatermarkofficeorgjourneyphpmonth12day3)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1293458:
fof(ax3_399,axiom,(
    genls(c_bqnd3,c_partiallytangible) )).

fof(ax3_400,axiom,(
    ! [OBJ] :
      ( bqnd3(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1744016:
fof(ax3_401,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_lake))
     => partiallytangible(OBJ) ) )).

fof(ax3_402,axiom,(
    genls(f_groupfn(c_lake),c_partiallytangible) )).

fof(ax3_403,axiom,(
    ! [OBJ] :
      ( groupfnlake(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #949783:
fof(ax3_404,axiom,(
    genls(c_counterintelligenceorganization,c_individual) )).

fof(ax3_405,axiom,(
    ! [OBJ] :
      ( counterintelligenceorganization(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2175270:
fof(ax3_406,axiom,(
    genlmt(c_tptp_member1084_mt,c_basekb) )).

% Cyc Assertion #1093702:
fof(ax3_407,axiom,(
    genls(c_methylchlorosilane,c_partiallytangible) )).

fof(ax3_408,axiom,(
    ! [OBJ] :
      ( methylchlorosilane(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1580850:
fof(ax3_409,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_11),c_basekb) )).

% Cyc Assertion #1252568:
fof(ax3_410,axiom,(
    genls(c_pfizercardiovascularmarket,c_individual) )).

fof(ax3_411,axiom,(
    ! [OBJ] :
      ( pfizercardiovascularmarket(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1634998:
fof(ax3_412,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_figurativelanguage,c_individual,s_34272f31_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_413,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_figurativelanguage,c_individual,s_34272f31_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_414,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryfigurativelanguageindividual34272f31_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #267195:
fof(ax3_415,axiom,(
    genlmt(c_textualentailmentproblemdescriptionmt,c_basekb) )).

% Cyc Assertion #937723:
fof(ax3_416,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtruluckcomhtmlabout_the_authorhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #218043:
fof(ax3_417,axiom,(
    genls(c_nltaggedterm,c_thing) )).

fof(ax3_418,axiom,(
    ! [OBJ] :
      ( nltaggedterm(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2176699:
fof(ax3_419,axiom,(
    genlmt(c_tptp_member1441_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #293912:
fof(ax3_420,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_cnncom_august_2_2005),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #1757314:
fof(ax3_421,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_s6invisionfreecom80s_cartoonsindexphpshowtopic2854)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #325166:
fof(ax3_422,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dailyblabberivillagecomentertainmentarchives200511desperate_house_1html)),c_translation_31),c_basekb) )).

% Cyc Assertion #1521967:
fof(ax3_423,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3kl4jsuoh8nvf_encodingutf8)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #443886:
fof(ax3_424,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommpahtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #630336:
fof(ax3_425,axiom,(
    transitivebinarypredicate(c_requisitefor) )).

% Cyc Assertion #2355756:
fof(ax3_426,axiom,
    ( mtvisible(c_tptp_member2177_mt)
   => isa(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_309,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)) )).

fof(ax3_427,axiom,
    ( mtvisible(c_tptp_member2177_mt)
   => subcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_309) )).

% Cyc Assertion #1395476:
fof(ax3_428,axiom,(
    genlmt(c_cycsecurenetworkfeaturesmt,c_basekb) )).

% Cyc Assertion #872193:
fof(ax3_429,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_12),c_basekb) )).

% Cyc Assertion #807061:
fof(ax3_430,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_17),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185262:
fof(ax3_431,axiom,(
    genlmt(c_tptp_member3582_mt,c_basekb) )).

% Cyc Assertion #2182910:
fof(ax3_432,axiom,(
    genlmt(c_tptp_member2994_mt,c_basekb) )).

% Cyc Assertion #297743:
fof(ax3_433,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwendervidualismcomagorastargate_1994htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1431765:
fof(ax3_434,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmbugcomdb36609)),c_translation_24),c_basekb) )).

% Cyc Assertion #2174082:
fof(ax3_435,axiom,(
    genlmt(c_tptp_member787_mt,c_basekb) )).

% Cyc Assertion #934101:
fof(ax3_436,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_egypt))
     => individual(OBJ) ) )).

fof(ax3_437,axiom,(
    genls(f_residentfn(c_egypt),c_individual) )).

fof(ax3_438,axiom,(
    ! [OBJ] :
      ( residentfnegypt(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1605568:
fof(ax3_439,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetgeographicalregionbodyofwaterprovincelandtopographicalfeaturecountyindependentcountrycityairport_physicalcontinentroadwaycountrysubsidiary(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1334848:
fof(ax3_440,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_peopleulethcapeteralwardcourseslanguagelang02pn_puzzleshtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172422:
fof(ax3_441,axiom,(
    genlmt(c_tptp_member372_mt,c_basekb) )).

% Cyc Assertion #865287:
fof(ax3_442,axiom,(
    genls(c_planneraxiomatizedfault,c_individual) )).

fof(ax3_443,axiom,(
    ! [OBJ] :
      ( planneraxiomatizedfault(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #653843:
fof(ax3_444,axiom,(
    individual(f_computervulnerabilityreportfn(c_bugtraqfaultdatabase,s_3928)) )).

% Cyc Assertion #1451054:
fof(ax3_445,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertoffset0)),c_translation_30),c_basekb) )).

% Cyc Assertion #2177642:
fof(ax3_446,axiom,(
    genlmt(c_tptp_member1677_mt,c_basekb) )).

% Cyc Assertion #2095397:
fof(ax3_447,axiom,(
    genls(c_tptpcol_10_109061,c_tptpcol_9_109060) )).

fof(ax3_448,axiom,(
    ! [OBJ] :
      ( tptpcol_10_109061(OBJ)
     => tptpcol_9_109060(OBJ) ) )).

% Cyc Assertion #1057978:
fof(ax3_449,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_person,c_isleaderof,c_tribalyouthfederation))
     => partiallytangible(OBJ) ) )).

fof(ax3_450,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_person,c_isleaderof,c_tribalyouthfederation),c_partiallytangible) )).

fof(ax3_451,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnpersonisleaderoftribalyouthfederation(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #807478:
fof(ax3_452,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdelfininternationalcom3dvd6htm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #662717:
fof(ax3_453,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_medeasmedialistsblueblogchcinema)),c_translation_30),c_basekb) )).

% Cyc Assertion #506075:
fof(ax3_454,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreadiocomarchives030205bbroadway5html)),c_translation_27),c_basekb) )).

% Cyc Assertion #2173062:
fof(ax3_455,axiom,(
    genlmt(c_tptp_member532_mt,c_basekb) )).

% Cyc Assertion #1350793:
fof(ax3_456,axiom,(
    genlmt(f_contentmtfn(c_nationalatlas_countyp020_ks),c_basekb) )).

% Cyc Assertion #1433592:
fof(ax3_457,axiom,(
    genlmt(c_patternsofglobalterrorism2000mt,c_basekb) )).

% Cyc Assertion #1121702:
fof(ax3_458,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrhdservicescomrhd20serviceshtm)),c_translation_11),c_basekb) )).

% Cyc Assertion #2185159:
fof(ax3_459,axiom,(
    genlmt(c_tptp_member3556_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #418741:
fof(ax3_460,axiom,(
    genls(c_cyclexpression_askable,c_thing) )).

fof(ax3_461,axiom,(
    ! [OBJ] :
      ( cyclexpression_askable(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1146464:
fof(ax3_462,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1684244:
fof(ax3_463,axiom,(
    waterbodyconcept(c_geographicalsubregions) )).

% Cyc Assertion #387649:
fof(ax3_464,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcrimelibrarycomterrorists_spiesterroristselsayid_nosair8htmlsect22)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #346688:
fof(ax3_465,axiom,(
    genlmt(c_strategicassessment1997mt,c_basekb) )).

% Cyc Assertion #916429:
fof(ax3_466,axiom,(
    genlmt(c_organizationdatamt,c_peopledatamt) )).

% Cyc Assertion #274847:
fof(ax3_467,axiom,(
    genls(c_contractorpreparation,c_individual) )).

fof(ax3_468,axiom,(
    ! [OBJ] :
      ( contractorpreparation(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #762253:
fof(ax3_469,axiom,(
    genlmt(c_horusmilitaryunitontologymappingmt,c_basekb) )).

% Cyc Assertion #727736:
fof(ax3_470,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkaraokeinfocoukforumforum_postsasptid887tpn2)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1500453:
fof(ax3_471,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdiscoverourtowncomtownpagephptown105catattractions)),c_translation_1),c_basekb) )).

% Cyc Assertion #1611570:
fof(ax3_472,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwuniversitysportcaestory_detailcfmid6284)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1302133:
fof(ax3_473,axiom,(
    genls(c_battletank_prctype69,c_individual) )).

fof(ax3_474,axiom,(
    ! [OBJ] :
      ( battletank_prctype69(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2171222:
fof(ax3_475,axiom,(
    genlmt(c_tptp_member72_mt,c_basekb) )).

% Cyc Assertion #1800444:
fof(ax3_476,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrnscompages4action96html)),c_translation_26),c_basekb) )).

% Cyc Assertion #713840:
fof(ax3_477,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdefenselinkmilnewsfeb2002n02142002_200202141html)),c_translation_0),c_basekb) )).

% Cyc Assertion #683824:
fof(ax3_478,axiom,(
    genlmt(c_lawofuniversalgravitationmt,c_basekb) )).

% Cyc Assertion #1058871:
fof(ax3_479,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_partiallytangible,c_velocityofobject,c_stationary))
     => partiallytangible(OBJ) ) )).

fof(ax3_480,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_partiallytangible,c_velocityofobject,c_stationary),c_partiallytangible) )).

fof(ax3_481,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnpartiallytangiblevelocityofobjectstationary(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1360041:
fof(ax3_482,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwirishaccommodationguidecomhotels_in_irelandantrimhtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1296912:
fof(ax3_483,axiom,(
    genlmt(c_temporarylexicalassertions_guessedmt,c_basekb) )).

% Cyc Assertion #2179138:
fof(ax3_484,axiom,(
    genlmt(c_tptp_member2051_mt,c_basekb) )).

% Cyc Assertion #1695275:
fof(ax3_485,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_attemptingfn(f_facilitatingfn(c_remembering)))
     => individual(OBJ) ) )).

fof(ax3_486,axiom,(
    genls(f_attemptingfn(f_facilitatingfn(c_remembering)),c_individual) )).

fof(ax3_487,axiom,(
    ! [OBJ] :
      ( attemptingfnfacilitatingfnremembering(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1710313:
fof(ax3_488,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_catholicsensibilityblogspotcom2005_10_01_catholicsensibility_archivehtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173774:
fof(ax3_489,axiom,(
    genlmt(c_tptp_member710_mt,c_basekb) )).

% Cyc Assertion #860930:
fof(ax3_490,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_whatisthecapitalofcomstate_capitalsstate_capitals_tf1html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #227539:
fof(ax3_491,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadiannorthern_foundationcanadaright)),c_translation_0),c_basekb) )).

% Cyc Assertion #1178733:
fof(ax3_492,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_21),c_machinelearningspindleheadmt) )).

% Cyc Assertion #554146:
fof(ax3_493,axiom,(
    genls(c_chlorosulfonicacid,c_partiallytangible) )).

fof(ax3_494,axiom,(
    ! [OBJ] :
      ( chlorosulfonicacid(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #981594:
fof(ax3_495,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwitvsorgoutsidelookinginfilmhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1631854:
fof(ax3_496,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_stjosephsshinskcaviewscold_temp2htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1030299:
fof(ax3_497,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_yemen))
     => individual(OBJ) ) )).

fof(ax3_498,axiom,(
    genls(f_residentfn(c_yemen),c_individual) )).

fof(ax3_499,axiom,(
    ! [OBJ] :
      ( residentfnyemen(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2186018:
fof(ax3_500,axiom,(
    genlmt(c_tptp_member3771_mt,c_basekb) )).

% Cyc Assertion #599281:
fof(ax3_501,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_atom))
     => partiallytangible(OBJ) ) )).

fof(ax3_502,axiom,(
    genls(f_groupfn(c_atom),c_partiallytangible) )).

fof(ax3_503,axiom,(
    ! [OBJ] :
      ( groupfnatom(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2173786:
fof(ax3_504,axiom,(
    genlmt(c_tptp_member713_mt,c_basekb) )).

% Cyc Assertion #795976:
fof(ax3_505,axiom,(
    genlmt(c_sectionh5templatemt,c_basekb) )).

% Cyc Assertion #170028:
fof(ax3_506,axiom,(
    genlmt(f_contentmtfn(c_fg1_language_hl_id_ks),c_basekb) )).

% Cyc Assertion #1668926:
fof(ax3_507,axiom,(
    applicationcontext(c_templateparsingmt) )).

% Cyc Assertion #1401625:
fof(ax3_508,axiom,(
    arg2isa(c_partiallyoverlappingspaceregions,c_homogeneouspositivedimensionalspaceregion) )).

fof(ax3_509,axiom,(
    ! [ARG1,ARG2] :
      ( partiallyoverlappingspaceregions(ARG1,ARG2)
     => homogeneouspositivedimensionalspaceregion(ARG2) ) )).

% Cyc Assertion #916884:
fof(ax3_510,axiom,(
    genlmt(f_contentmtfn(c_glassbox_collaboration_ks),c_basekb) )).

% Cyc Assertion #869844:
fof(ax3_511,axiom,(
    genls(c_usedartifact,c_artifact) )).

fof(ax3_512,axiom,(
    ! [OBJ] :
      ( usedartifact(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #153172:
fof(ax3_513,axiom,(
    genlmt(c_judeo_christianmt,c_basekb) )).

% Cyc Assertion #431025:
fof(ax3_514,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbasicstepsorgenglishnewtestamentstep10l7htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #539983:
fof(ax3_515,axiom,(
    genlmt(c_tmsloopmt,c_basekb) )).

% Cyc Assertion #788871:
fof(ax3_516,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_lifsostypepadcomlulled_into_a_false_sense200509another_one_makhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2174702:
fof(ax3_517,axiom,(
    genlmt(c_tptp_member942_mt,c_basekb) )).

% Cyc Assertion #204363:
fof(ax3_518,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_blogouter_courtcomegobrowsertim_allenhtml)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182614:
fof(ax3_519,axiom,(
    genlmt(c_tptp_member2920_mt,c_basekb) )).

% Cyc Assertion #2053411:
fof(ax3_520,axiom,(
    genls(c_tptpcol_15_92268,c_tptpcol_14_92264) )).

fof(ax3_521,axiom,(
    ! [OBJ] :
      ( tptpcol_15_92268(OBJ)
     => tptpcol_14_92264(OBJ) ) )).

% Cyc Assertion #2393708:
fof(ax3_522,axiom,(
    individual(c_tptpnmobfnnapkin_4) )).

% Cyc Assertion #1329028:
fof(ax3_523,axiom,(
    intelligentagenttypebybeliefsystem(f_believerfn(c_atheism)) )).

% Cyc Assertion #1310373:
fof(ax3_524,axiom,(
    genlmt(c_alpha_infoconlevelmt,c_basekb) )).

% Cyc Assertion #2183058:
fof(ax3_525,axiom,(
    genlmt(c_tptp_member3031_mt,c_basekb) )).

% Cyc Assertion #138632:
fof(ax3_526,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtopsynergycomfamousmichael_douglasasp)),c_translation_31),c_basekb) )).

% Cyc Assertion #1787435:
fof(ax3_527,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomjames_cutter001rmhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173342:
fof(ax3_528,axiom,(
    genlmt(c_tptp_member602_mt,c_basekb) )).

% Cyc Assertion #1450657:
fof(ax3_529,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwzmagorgzmagzarticlecfmurlarticlesmartinezjume98htm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #949290:
fof(ax3_530,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbfiorguksightandsoundreviewsdetailsphpid197)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1157259:
fof(ax3_531,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwordsoftruthnetwordsoftruthbull04_17_2005html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #691630:
fof(ax3_532,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtnttvtitleoid324281_1151)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1635384:
fof(ax3_533,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrensecomgeneral18militantjewishactivistshtm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2180314:
fof(ax3_534,axiom,(
    genlmt(c_tptp_member2345_mt,c_basekb) )).

% Cyc Assertion #2186030:
fof(ax3_535,axiom,(
    genlmt(c_tptp_member3774_mt,c_basekb) )).

% Cyc Assertion #1166105:
fof(ax3_536,axiom,(
    genlmt(c_necessitymt,c_basekb) )).

% Cyc Assertion #1692660:
fof(ax3_537,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #249877:
fof(ax3_538,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhitdvdnetdvdinfo8876reviews1)),c_translation_33),c_basekb) )).

% Cyc Assertion #974757:
fof(ax3_539,axiom,(
    genlmt(c_unitedstatesgeographydualistmt,c_worldgeographydualistmt) )).

% Cyc Assertion #540595:
fof(ax3_540,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhssenieedusgstaffkahackwomenhtm)),c_translation_15),c_machinelearningspindleheadmt) )).

% Cyc Assertion #469908:
fof(ax3_541,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpublishersweeklycomarticleca505004htmlpubdate22f212f2005displayarchive)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #446361:
fof(ax3_542,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwteenreadscomreviews0679751130asp)),c_translation_33),c_basekb) )).

% Cyc Assertion #356502:
fof(ax3_543,axiom,(
    genlmt(c_kerelevance_basedinterestingnessrulesmt,c_basekb) )).

% Cyc Assertion #1415143:
fof(ax3_544,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviemakercomissues05videohtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1493047:
fof(ax3_545,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwimdbcomtitlett0398417usercomments)),c_translation_33),c_basekb) )).

% Cyc Assertion #452020:
fof(ax3_546,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #247876:
fof(ax3_547,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_29),c_basekb) )).

% Cyc Assertion #2359224:
fof(ax3_548,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member235_mt)
        & ridgeline_topographical(INS) )
     => tptpofobject(INS,f_tptpquantityfn_13(n_468)) ) )).

fof(ax3_549,axiom,
    ( mtvisible(c_tptp_member235_mt)
   => relationallinstance(c_tptpofobject,c_ridgeline_topographical,f_tptpquantityfn_13(n_468)) )).

% Cyc Assertion #1716784:
fof(ax3_550,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwunlocker_forumscoukshowthreadphpt832)),c_translation_33),c_basekb) )).

% Cyc Assertion #529051:
fof(ax3_551,axiom,(
    genls(c_modalreasoningmicrotheory,c_microtheory) )).

fof(ax3_552,axiom,(
    ! [OBJ] :
      ( modalreasoningmicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #1552010:
fof(ax3_553,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnzfilmconzdownloadsnz20film20issue2073pdf)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1478968:
fof(ax3_554,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richmondthenandnowcomfamous_people_richmond_4html)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1747072:
fof(ax3_555,axiom,(
    genls(c_pathsystemcyclconstant,c_thing) )).

fof(ax3_556,axiom,(
    ! [OBJ] :
      ( pathsystemcyclconstant(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1359694:
fof(ax3_557,axiom,(
    genls(c_usadministrativedivision,c_partiallytangible) )).

fof(ax3_558,axiom,(
    ! [OBJ] :
      ( usadministrativedivision(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1140437:
fof(ax3_559,axiom,(
    genls(c_threateningtodoshootingsomeoneexecutionstyle,c_individual) )).

fof(ax3_560,axiom,(
    ! [OBJ] :
      ( threateningtodoshootingsomeoneexecutionstyle(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #798688:
fof(ax3_561,axiom,(
    genlmt(c_mett_tc_terrainanalysismt,c_basekb) )).

% Cyc Assertion #2004514:
fof(ax3_562,axiom,(
    genls(c_tptpcol_7_72707,c_tptpcol_6_71683) )).

fof(ax3_563,axiom,(
    ! [OBJ] :
      ( tptpcol_7_72707(OBJ)
     => tptpcol_6_71683(OBJ) ) )).

% Cyc Assertion #139074:
fof(ax3_564,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhwdhospitalradiocomretro_hour_1979shtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1294181:
fof(ax3_565,axiom,(
    genlmt(c_corecyclmt,c_corecyclimplementationmt) )).

% Cyc Assertion #1385317:
fof(ax3_566,axiom,(
    genls(c_applicationcontext,c_microtheory) )).

fof(ax3_567,axiom,(
    ! [OBJ] :
      ( applicationcontext(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #2186798:
fof(ax3_568,axiom,(
    genlmt(c_tptp_member3966_mt,c_basekb) )).

% Cyc Assertion #1281869:
fof(ax3_569,axiom,(
    genlmt(c_dcsuperheroesmt,c_basekb) )).

% Cyc Assertion #2176170:
fof(ax3_570,axiom,(
    genlmt(c_tptp_member1309_mt,c_basekb) )).

% Cyc Assertion #353065:
fof(ax3_571,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweonlinecomnewsitems011107000html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #555178:
fof(ax3_572,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwspreadinglightcomcontemporaryhomosexualityhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1207209:
fof(ax3_573,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_26),c_basekb) )).

% Cyc Assertion #1680236:
fof(ax3_574,axiom,(
    genlmt(c_verysimplecookingworldtestcasegroundtruthmt,c_basekb) )).

% Cyc Assertion #2174574:
fof(ax3_575,axiom,(
    genlmt(c_tptp_member910_mt,c_basekb) )).

% Cyc Assertion #379512:
fof(ax3_576,axiom,(
    genlmt(c_pdatemplatetestmt,c_humansociallifemt) )).

% Cyc Assertion #407771:
fof(ax3_577,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #343810:
fof(ax3_578,axiom,(
    genlmt(c_mysentientkeirrelevanceforquestionansweringmt,c_basekb) )).

% Cyc Assertion #713763:
fof(ax3_579,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_stream))
     => partiallytangible(OBJ) ) )).

fof(ax3_580,axiom,(
    genls(f_groupfn(c_stream),c_partiallytangible) )).

fof(ax3_581,axiom,(
    ! [OBJ] :
      ( groupfnstream(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #374146:
fof(ax3_582,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1635400:
fof(ax3_583,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_specswithquantityfn(f_vaccineforagainstfn(c_homosapiens,c_anthraxinfection),c_expensive))
     => collection(OBJ) ) )).

fof(ax3_584,axiom,(
    genls(f_specswithquantityfn(f_vaccineforagainstfn(c_homosapiens,c_anthraxinfection),c_expensive),c_collection) )).

fof(ax3_585,axiom,(
    ! [OBJ] :
      ( specswithquantityfnvaccineforagainstfnhomosapiensanthraxinfectionexpensive(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #289122:
fof(ax3_586,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_hitavehiclebelongingtothejammuandkashmirspeoplesdemocraticpartyitmissedthetargetandhitagroupofcivilians,c_actiononobject,s_341024c5_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_587,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_hitavehiclebelongingtothejammuandkashmirspeoplesdemocraticpartyitmissedthetargetandhitagroupofcivilians,c_actiononobject,s_341024c5_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_588,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternaryhitavehiclebelongingtothejammuandkashmirspeoplesdemocraticpartyitmissedthetargetandhitagroupofciviliansactiononobject341024c5_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #926524:
fof(ax3_589,axiom,(
    genlmt(c_nationalbriefings_iranmt,c_hpkbvocabmt) )).

% Cyc Assertion #386710:
fof(ax3_590,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1023165:
fof(ax3_591,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mediamattersorgitems200409240005)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #616871:
fof(ax3_592,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomjames_cutter001rmhtm)),c_translation_19),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1431394:
fof(ax3_593,axiom,(
    genls(c_anniversaryflowerarrangement,c_artifact) )).

fof(ax3_594,axiom,(
    ! [OBJ] :
      ( anniversaryflowerarrangement(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1793339:
fof(ax3_595,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwskycomshowbizarticle050001_117309100html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2309099:
fof(ax3_596,axiom,(
    transitivebinarypredicate(c_tptpnonterminatingtransitivepredicate_7) )).

% Cyc Assertion #2481672:
fof(ax3_597,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x46_y6) )).

% Cyc Assertion #2188270:
fof(ax3_598,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_cyclistsmt)
        & isa(TERM,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )
     => tptp_9_395(TERM,f_relationallexistsfn(TERM,c_tptp_9_395,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_19212)) ) )).

fof(ax3_599,axiom,
    ( mtvisible(c_cyclistsmt)
   => relationallexists(c_tptp_9_395,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_19212) )).

% Cyc Assertion #761906:
fof(ax3_600,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_21),c_basekb) )).

% Cyc Assertion #1179609:
fof(ax3_601,axiom,(
    genls(c_cblsensor,c_individual) )).

fof(ax3_602,axiom,(
    ! [OBJ] :
      ( cblsensor(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1262479:
fof(ax3_603,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(c_bus_roadvehicle,c_possessiverelation,c_israel))
     => partiallytangible(OBJ) ) )).

fof(ax3_604,axiom,(
    genls(f_subcollectionofwithrelationfromfn(c_bus_roadvehicle,c_possessiverelation,c_israel),c_partiallytangible) )).

fof(ax3_605,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnbus_roadvehiclepossessiverelationisrael(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2183398:
fof(ax3_606,axiom,(
    genlmt(c_tptp_member3116_mt,c_basekb) )).

% Cyc Assertion #1217117:
fof(ax3_607,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbeyondpesticidesorginfoservicespesticidefactsheetstoxicrodenticidehtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1166584:
fof(ax3_608,axiom,(
    genlmt(c_oileconmodelmt,c_hpkbvocabmt) )).

% Cyc Assertion #458291:
fof(ax3_609,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwteenreadscomreviews0679751130asp)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2174098:
fof(ax3_610,axiom,(
    genlmt(c_tptp_member791_mt,c_basekb) )).

% Cyc Assertion #2192247:
fof(ax3_611,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_cyclistsmt)
        & isa(TERM,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )
     => tptp_9_28(TERM,f_relationallexistsfn(TERM,c_tptp_9_28,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_15_30772)) ) )).

fof(ax3_612,axiom,
    ( mtvisible(c_cyclistsmt)
   => relationallexists(c_tptp_9_28,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_15_30772) )).

% Cyc Assertion #1207296:
fof(ax3_613,axiom,(
    genls(c_hermitage,c_partiallytangible) )).

fof(ax3_614,axiom,(
    ! [OBJ] :
      ( hermitage(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1327562:
fof(ax3_615,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #950400:
fof(ax3_616,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwchroncomcontentchroniclefeaturesvideo97mainhtml)),c_translation_31),c_basekb) )).

% Cyc Assertion #843507:
fof(ax3_617,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwglennfordbiocomfordhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #621268:
fof(ax3_618,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetruinedartifacttown(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1369892:
fof(ax3_619,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetbittertastebitterodor(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2174154:
fof(ax3_620,axiom,(
    genlmt(c_tptp_member805_mt,c_basekb) )).

% Cyc Assertion #932627:
fof(ax3_621,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_artsedgekennedy_centerorgcontent3498)),c_translation_9),c_basekb) )).

% Cyc Assertion #2177074:
fof(ax3_622,axiom,(
    genlmt(c_tptp_member1535_mt,c_basekb) )).

% Cyc Assertion #607318:
fof(ax3_623,axiom,(
    genlmt(c_temporalprepositionsensesmt,c_basekb) )).

% Cyc Assertion #569470:
fof(ax3_624,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcifremontcausaboutfremonthistoryeraoftownshtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #360113:
fof(ax3_625,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbelfastislamiccentreorgukvisitorsguidehtm)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1648477:
fof(ax3_626,axiom,(
    genls(c_kbcontenttestforaquaintkbpiloteval_supplemental,c_individual) )).

fof(ax3_627,axiom,(
    ! [OBJ] :
      ( kbcontenttestforaquaintkbpiloteval_supplemental(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #653219:
fof(ax3_628,axiom,
    ( mtvisible(c_cycapimt)
   => arg1isa(c_sublsymbolentityfn,c_collection) )).

% Cyc Assertion #966021:
fof(ax3_629,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_companionofman,c_individual,s_33d7afa6_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_630,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_companionofman,c_individual,s_33d7afa6_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_631,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarycompanionofmanindividual33d7afa6_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2326633:
fof(ax3_632,axiom,
    ( mtvisible(c_tptp_member563_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_97) )).

% Cyc Assertion #921639:
fof(ax3_633,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_formerpersontypefn(f_subcollectionofwithrelationtotypefn(f_frequentperformerfn(c_activism),c_affiliatedwith,c_legislativeorganization)))
     => individual(OBJ) ) )).

fof(ax3_634,axiom,(
    genls(f_formerpersontypefn(f_subcollectionofwithrelationtotypefn(f_frequentperformerfn(c_activism),c_affiliatedwith,c_legislativeorganization)),c_individual) )).

fof(ax3_635,axiom,(
    ! [OBJ] :
      ( formerpersontypefnsubcollectionofwithrelationtotypefnfrequentperformerfnactivismaffiliatedwithlegislativeorganization(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1326888:
fof(ax3_636,axiom,(
    genlmt(c_dualistgeopoliticalmt,c_geographymt) )).

% Cyc Assertion #368629:
fof(ax3_637,axiom,(
    genls(c_sentenceevaluationoutput,c_collection) )).

fof(ax3_638,axiom,(
    ! [OBJ] :
      ( sentenceevaluationoutput(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1419350:
fof(ax3_639,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertlahroffset0)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #866138:
fof(ax3_640,axiom,(
    genlmt(f_contextofpcwfn(c_terminator2_themovie),c_humansociallifemt) )).

% Cyc Assertion #1552245:
fof(ax3_641,axiom,(
    genls(c_manufactureraluminum,c_individual) )).

fof(ax3_642,axiom,(
    ! [OBJ] :
      ( manufactureraluminum(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1281330:
fof(ax3_643,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_pittsburghbizjournalscomtriadstories20040105daily32html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #321312:
fof(ax3_644,axiom,(
    existingobjecttype(c_harleydavidsonmotorcycle) )).

% Cyc Assertion #2172490:
fof(ax3_645,axiom,(
    genlmt(c_tptp_member389_mt,c_basekb) )).

% Cyc Assertion #154726:
fof(ax3_646,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_33),c_basekb) )).

% Cyc Assertion #857224:
fof(ax3_647,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_accessoryfn_activity(f_playingfn(c_hockey)))
     => artifact(OBJ) ) )).

fof(ax3_648,axiom,(
    genls(f_accessoryfn_activity(f_playingfn(c_hockey)),c_artifact) )).

fof(ax3_649,axiom,(
    ! [OBJ] :
      ( accessoryfn_activityplayingfnhockey(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1392845:
fof(ax3_650,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtheologywebcomcampusshowthreadphpt58060page3)),c_translation_33),c_basekb) )).

% Cyc Assertion #1400063:
fof(ax3_651,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycombenhecht)),c_translation_25),c_basekb) )).

% Cyc Assertion #2176686:
fof(ax3_652,axiom,(
    genlmt(c_tptp_member1438_mt,c_basekb) )).

% Cyc Assertion #2182070:
fof(ax3_653,axiom,(
    genlmt(c_tptp_member2784_mt,c_basekb) )).

% Cyc Assertion #714450:
fof(ax3_654,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #832631:
fof(ax3_655,axiom,(
    genlmt(c_waemplacingbridgemt,c_basekb) )).

% Cyc Assertion #488191:
fof(ax3_656,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_27),c_basekb) )).

% Cyc Assertion #1266458:
fof(ax3_657,axiom,(
    genls(c_navaid,c_partiallytangible) )).

fof(ax3_658,axiom,(
    ! [OBJ] :
      ( navaid(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1900167:
fof(ax3_659,axiom,(
    genls(c_tptpcol_16_30971,c_tptpcol_15_30970) )).

fof(ax3_660,axiom,(
    ! [OBJ] :
      ( tptpcol_16_30971(OBJ)
     => tptpcol_15_30970(OBJ) ) )).

% Cyc Assertion #633090:
fof(ax3_661,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_collegehmcocomhistoryreaderscompgahffhtmlff_103400_jonesjameseahtm)),c_translation_16),c_basekb) )).

% Cyc Assertion #971010:
fof(ax3_662,axiom,(
    genls(c_sensor,c_partiallytangible) )).

fof(ax3_663,axiom,(
    ! [OBJ] :
      ( sensor(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1782006:
fof(ax3_664,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhwdhospitalradiocomretro_hour_1979shtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1333702:
fof(ax3_665,axiom,(
    genlmt(c_enemymovementmt,c_basekb) )).

% Cyc Assertion #2181230:
fof(ax3_666,axiom,(
    genlmt(c_tptp_member2574_mt,c_basekb) )).

% Cyc Assertion #2213691:
fof(ax3_667,axiom,
    ( mtvisible(c_tptp_member2212_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_4) )).

% Cyc Assertion #1544221:
fof(ax3_668,axiom,(
    genls(c_attemptingkilling_biologicalsubeventstorture,c_individual) )).

fof(ax3_669,axiom,(
    ! [OBJ] :
      ( attemptingkilling_biologicalsubeventstorture(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #220793:
fof(ax3_670,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_jewishsettlement,c_partiallytangible,s_340b69d0_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_671,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_jewishsettlement,c_partiallytangible,s_340b69d0_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_672,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryjewishsettlementpartiallytangible340b69d0_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1576194:
fof(ax3_673,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnextagcomgone_with_the_wind__zz3882991z2z0z200361z1z200361zb66z2__compare_prices_html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #237041:
fof(ax3_674,axiom,(
    genlmt(c_englishmt,c_basekb) )).

% Cyc Assertion #2179770:
fof(ax3_675,axiom,(
    genlmt(c_tptp_member2209_mt,c_basekb) )).

% Cyc Assertion #2183143:
fof(ax3_676,axiom,(
    genlmt(c_tptp_member3052_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #930743:
fof(ax3_677,axiom,(
    genlmt(c_oldlatinlexicalmt,c_basekb) )).

% Cyc Assertion #1807226:
fof(ax3_678,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_blogouter_courtcomegobrowsertim_allenhtml)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1400629:
fof(ax3_679,axiom,(
    genlmt(c_eberttemplatemt,c_basekb) )).

% Cyc Assertion #763651:
fof(ax3_680,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdelfininternationalcom3dvd6htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #171941:
fof(ax3_681,axiom,(
    genls(c_infiltrationlane,c_geographicalregion) )).

fof(ax3_682,axiom,(
    ! [OBJ] :
      ( infiltrationlane(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #855530:
fof(ax3_683,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomlorettapageirishtellmahtml)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #735295:
fof(ax3_684,axiom,(
    genls(c_mexicancuisine,c_artifact) )).

fof(ax3_685,axiom,(
    ! [OBJ] :
      ( mexicancuisine(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1218797:
fof(ax3_686,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordkryptonoffset0)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2179938:
fof(ax3_687,axiom,(
    genlmt(c_tptp_member2251_mt,c_basekb) )).

% Cyc Assertion #1620206:
fof(ax3_688,axiom,(
    ! [OBJ] :
      ( ls_0(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2185046:
fof(ax3_689,axiom,(
    genlmt(c_tptp_member3528_mt,c_basekb) )).

% Cyc Assertion #808485:
fof(ax3_690,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleadingauthoritiescomtalentaallen_debbieallen_debbiedoc)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #867530:
fof(ax3_691,axiom,(
    genlmt(c_naiveinformationmt,c_basekb) )).

% Cyc Assertion #1098760:
fof(ax3_692,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweverestmaxcomnepalhtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2180978:
fof(ax3_693,axiom,(
    genlmt(c_tptp_member2511_mt,c_basekb) )).

% Cyc Assertion #1661901:
fof(ax3_694,axiom,(
    genlmt(c_aspecttense_inferencemt,c_basekb) )).

% Cyc Assertion #1190541:
fof(ax3_695,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_azerbaijan))
     => individual(OBJ) ) )).

fof(ax3_696,axiom,(
    genls(f_residentfn(c_azerbaijan),c_individual) )).

fof(ax3_697,axiom,(
    ! [OBJ] :
      ( residentfnazerbaijan(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1455104:
fof(ax3_698,axiom,(
    genlmt(f_contentmtheadfn(c_yahoomoviesguide_ks),c_basekb) )).

% Cyc Assertion #353183:
fof(ax3_699,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvirtualtouristcomtravelmiddle_eastirangeneral_tips_iran_br_3html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1543336:
fof(ax3_700,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1783388:
fof(ax3_701,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwyouthvoteorgnewsnewsdetailcfmnewsid544)),c_translation_2),c_basekb) )).

% Cyc Assertion #1575513:
fof(ax3_702,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrensecomgeneral18militantjewishactivistshtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2177922:
fof(ax3_703,axiom,(
    genlmt(c_tptp_member1747_mt,c_basekb) )).

% Cyc Assertion #956511:
fof(ax3_704,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtvcomhome_improvementbackstage_passepisode23169summaryhtml)),c_translation_25),c_basekb) )).

% Cyc Assertion #226252:
fof(ax3_705,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_32),c_basekb) )).

% Cyc Assertion #2335431:
fof(ax3_706,axiom,
    ( mtvisible(c_tptp_member451_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_437) )).

% Cyc Assertion #182878:
fof(ax3_707,axiom,(
    genlmt(f_contextofpcwfn(c_malesshakehandswhensayinggoodbye_custom),c_humansociallifemt) )).

% Cyc Assertion #821980:
fof(ax3_708,axiom,(
    genlmt(c_biologicalsocialmt,c_basekb) )).

% Cyc Assertion #1778423:
fof(ax3_709,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_18),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1738068:
fof(ax3_710,axiom,(
    genlpreds(c_genls,c_subsetof) )).

fof(ax3_711,axiom,(
    ! [ARG1,ARG2] :
      ( genls(ARG1,ARG2)
     => subsetof(ARG1,ARG2) ) )).

% Cyc Assertion #921488:
fof(ax3_712,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_20),c_basekb) )).

% Cyc Assertion #431402:
fof(ax3_713,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_qa3724is_200209ai_n9094343)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #902091:
fof(ax3_714,axiom,(
    genls(c_conductingmedium,c_partiallytangible) )).

fof(ax3_715,axiom,(
    ! [OBJ] :
      ( conductingmedium(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2477752:
fof(ax3_716,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x20_y1) )).

% Cyc Assertion #1657211:
fof(ax3_717,axiom,(
    genls(c_informationdesignationtype,c_collection) )).

fof(ax3_718,axiom,(
    ! [OBJ] :
      ( informationdesignationtype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1102710:
fof(ax3_719,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_23),c_basekb) )).

% Cyc Assertion #1076933:
fof(ax3_720,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk2hientertainment4085469stm)),c_translation_2),c_basekb) )).

% Cyc Assertion #569752:
fof(ax3_721,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_main_points_of_un_resolution_on_syria),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1589314:
fof(ax3_722,axiom,(
    genlmt(c_pq32_114mt,c_testvocabularymt) )).

% Cyc Assertion #205299:
fof(ax3_723,axiom,(
    arg2isa(c_stringsused,c_characterstring) )).

fof(ax3_724,axiom,(
    ! [ARG1,ARG2] :
      ( stringsused(ARG1,ARG2)
     => characterstring(ARG2) ) )).

% Cyc Assertion #453737:
fof(ax3_725,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamerican_buddhacomseagalseigehtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #2171886:
fof(ax3_726,axiom,(
    genlmt(c_tptp_member238_mt,c_basekb) )).

% Cyc Assertion #613957:
fof(ax3_727,axiom,(
    genlmt(c_socreport_fbi_20030420b_reportcontent,c_basekb) )).

% Cyc Assertion #1114392:
fof(ax3_728,axiom,(
    genlmt(f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1997))),c_basekb) )).

% Cyc Assertion #1042088:
fof(ax3_729,axiom,
    ( mtvisible(c_modernmilitarymt)
   => genls(c_spur_topographical,c_geographicalregion) )).

fof(ax3_730,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_modernmilitarymt)
        & spur_topographical(OBJ) )
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1114093:
fof(ax3_731,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkscourtsorgksagopinions19941994_110htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2095395:
fof(ax3_732,axiom,(
    genls(c_tptpcol_9_109060,c_tptpcol_8_109059) )).

fof(ax3_733,axiom,(
    ! [OBJ] :
      ( tptpcol_9_109060(OBJ)
     => tptpcol_8_109059(OBJ) ) )).

% Cyc Assertion #1129453:
fof(ax3_734,axiom,
    ( mtvisible(c_cyccanonicalguidmappingmt)
   => bbnrelationtypepredicate(c_geographicalsubregions) )).

% Cyc Assertion #1201521:
fof(ax3_735,axiom,(
    genlmt(c_y2crisismt,c_basekb) )).

% Cyc Assertion #862129:
fof(ax3_736,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcueduirmabout_irmself_study96_theoryhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #846607:
fof(ax3_737,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_31),c_basekb) )).

% Cyc Assertion #600885:
fof(ax3_738,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_naturalgasprocessingplant,c_partiallytangible,s_340687d6_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_739,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_naturalgasprocessingplant,c_partiallytangible,s_340687d6_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_740,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarynaturalgasprocessingplantpartiallytangible340687d6_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #776795:
fof(ax3_741,axiom,(
    genls(c_partiallyintangibleindividual,c_partiallyintangible) )).

fof(ax3_742,axiom,(
    ! [OBJ] :
      ( partiallyintangibleindividual(OBJ)
     => partiallyintangible(OBJ) ) )).

% Cyc Assertion #958459:
fof(ax3_743,axiom,(
    genlmt(f_contextofpcwfn(c_removeshoesbeforeenteringhome),c_basekb) )).

% Cyc Assertion #2175830:
fof(ax3_744,axiom,(
    genlmt(c_tptp_member1224_mt,c_basekb) )).

% Cyc Assertion #1063624:
fof(ax3_745,axiom,(
    genlmt(c_commandtemplatemt,c_basekb) )).

% Cyc Assertion #2171290:
fof(ax3_746,axiom,(
    genlmt(c_tptp_member89_mt,c_basekb) )).

% Cyc Assertion #1676826:
fof(ax3_747,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_occupytheiraqiembassyinberlinactionwasendedafterafivehoursiegewithgermanpolice,c_actiononobject,s_34021b00_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_748,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_occupytheiraqiembassyinberlinactionwasendedafterafivehoursiegewithgermanpolice,c_actiononobject,s_34021b00_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_749,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternaryoccupytheiraqiembassyinberlinactionwasendedafterafivehoursiegewithgermanpoliceactiononobject34021b00_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2178014:
fof(ax3_750,axiom,(
    genlmt(c_tptp_member1770_mt,c_basekb) )).

% Cyc Assertion #625718:
fof(ax3_751,axiom,
    ( mtvisible(c_worldgeographymt)
   => state_geopolitical(c_damaraland_districtnamibia) )).

% Cyc Assertion #1123715:
fof(ax3_752,axiom,(
    genls(c_instancelevelscriptmicrotheory,c_microtheory) )).

fof(ax3_753,axiom,(
    ! [OBJ] :
      ( instancelevelscriptmicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #1067067:
fof(ax3_754,axiom,(
    genlmt(c_starseeker_actorsksmt,c_massmediadatamt) )).

% Cyc Assertion #1182085:
fof(ax3_755,axiom,(
    genlmt(c_alaska_hawaiitimezonemt,c_basekb) )).

% Cyc Assertion #1751141:
fof(ax3_756,axiom,(
    genls(c_abstractstructure,c_aspatialinformationstore) )).

fof(ax3_757,axiom,(
    ! [OBJ] :
      ( abstractstructure(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #2177394:
fof(ax3_758,axiom,(
    genlmt(c_tptp_member1615_mt,c_basekb) )).

% Cyc Assertion #930537:
fof(ax3_759,axiom,(
    genlmt(c_desertstormmilitarypresencemt,c_hpkbvocabmt) )).

% Cyc Assertion #1448865:
fof(ax3_760,axiom,(
    spatialcotemporalpredicate(c_incidentininteriorofspaceregion) )).

% Cyc Assertion #785997:
fof(ax3_761,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_divineangstblawgcoopcomarchives200503book_6html)),c_translation_2),c_basekb) )).

% Cyc Assertion #751468:
fof(ax3_762,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_legendstypepadcomliving_with_legends_the_h200507cult_fictionhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1328579:
fof(ax3_763,axiom,(
    genlmt(c_girlsjumpinginwaterimt,c_basekb) )).

% Cyc Assertion #2184726:
fof(ax3_764,axiom,(
    genlmt(c_tptp_member3448_mt,c_basekb) )).

% Cyc Assertion #165726:
fof(ax3_765,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_expositoryarticle_regime_is_trying_to_silence_internal_dissent),c_ldscgeneralcollectormt) )).

% Cyc Assertion #319441:
fof(ax3_766,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvdfevercouknewsnews0805shtml)),c_translation_6),c_basekb) )).

% Cyc Assertion #1485419:
fof(ax3_767,axiom,(
    genls(c_aircraftarrestinggear,c_partiallytangible) )).

fof(ax3_768,axiom,(
    ! [OBJ] :
      ( aircraftarrestinggear(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1157224:
fof(ax3_769,axiom,(
    transitivebinarypredicate(c_subqueries) )).

% Cyc Assertion #956689:
fof(ax3_770,axiom,(
    genls(c_metropolitanarea,c_geographicalregion) )).

fof(ax3_771,axiom,(
    ! [OBJ] :
      ( metropolitanarea(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #196559:
fof(ax3_772,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtelereadorgblog2004_10_24_archivehtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176891:
fof(ax3_773,axiom,(
    genlmt(c_tptp_member1489_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #2184662:
fof(ax3_774,axiom,(
    genlmt(c_tptp_member3432_mt,c_basekb) )).

% Cyc Assertion #2171018:
fof(ax3_775,axiom,(
    genlmt(c_tptp_member21_mt,c_basekb) )).

% Cyc Assertion #2176638:
fof(ax3_776,axiom,(
    genlmt(c_tptp_member1426_mt,c_basekb) )).

% Cyc Assertion #2185082:
fof(ax3_777,axiom,(
    genlmt(c_tptp_member3537_mt,c_basekb) )).

% Cyc Assertion #2477541:
fof(ax3_778,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x12_y6) )).

% Cyc Assertion #1873960:
fof(ax3_779,axiom,(
    genls(c_tptpcol_7_20485,c_tptpcol_6_20484) )).

fof(ax3_780,axiom,(
    ! [OBJ] :
      ( tptpcol_7_20485(OBJ)
     => tptpcol_6_20484(OBJ) ) )).

% Cyc Assertion #168160:
fof(ax3_781,axiom,(
    genls(c_bpvartifact,c_individual) )).

fof(ax3_782,axiom,(
    ! [OBJ] :
      ( bpvartifact(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1248607:
fof(ax3_783,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpoweripodsearchinfobrown_ipodhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #2180274:
fof(ax3_784,axiom,(
    genlmt(c_tptp_member2335_mt,c_basekb) )).

% Cyc Assertion #1110967:
fof(ax3_785,axiom,(
    genls(c_topologyconcept,c_thing) )).

fof(ax3_786,axiom,(
    ! [OBJ] :
      ( topologyconcept(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1498330:
fof(ax3_787,axiom,(
    genlmt(f_contextofpcwfn(c_socialistlawsystem),c_humansociallifemt) )).

% Cyc Assertion #1531585:
fof(ax3_788,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwuniversitysportcaestory_detailcfmid6284)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1619577:
fof(ax3_789,axiom,(
    genlmt(c_reasoningwithtense_inferencemt_mixeddateseries,c_basekb) )).

% Cyc Assertion #2418340:
fof(ax3_790,axiom,
    ( mtvisible(c_tptp_member1672_mt)
   => navypersonnel(c_tptpnavypersonnel_3) )).

% Cyc Assertion #1772311:
fof(ax3_791,axiom,(
    genlmt(f_mappingmtfn(c_nationalatlas_ks),c_basekb) )).

% Cyc Assertion #925290:
fof(ax3_792,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_ukencartamsncomencyclopedia_761573010_4united_states_of_americahtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #839228:
fof(ax3_793,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cheerleaderyozcomarchives001947html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2324462:
fof(ax3_794,axiom,(
    individual(c_tptptptpcol_16_28787) )).

% Cyc Assertion #875016:
fof(ax3_795,axiom,(
    genlmt(c_nounlearnerconjecturerulesmt,c_basekb) )).

% Cyc Assertion #221164:
fof(ax3_796,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_chemcofcedumsdsaallyl20alcoholhtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1421810:
fof(ax3_797,axiom,(
    genlmt(c_dualistgeopoliticalvocabularymt,c_geographymt) )).

% Cyc Assertion #1193677:
fof(ax3_798,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1271068:
fof(ax3_799,axiom,(
    genlmt(c_usarmscontrolanddisarmamentagencymt,c_basekb) )).

% Cyc Assertion #2185658:
fof(ax3_800,axiom,(
    genlmt(c_tptp_member3681_mt,c_basekb) )).

% Cyc Assertion #1250620:
fof(ax3_801,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjamieleecurtisoffset0)),c_translation_30),c_basekb) )).

% Cyc Assertion #162662:
fof(ax3_802,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetworkplacecommercialorganizationbusinessperson(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #636094:
fof(ax3_803,axiom,(
    genlmt(c_cycorpproductsmt,c_worldcompletegeographymt) )).

% Cyc Assertion #1464890:
fof(ax3_804,axiom,(
    genls(c_eonodedefinedbutneedsdeeperke,c_thing) )).

fof(ax3_805,axiom,(
    ! [OBJ] :
      ( eonodedefinedbutneedsdeeperke(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2027552:
fof(ax3_806,axiom,(
    genls(c_tptpcol_3_81921,c_tptpcol_2_65537) )).

fof(ax3_807,axiom,(
    ! [OBJ] :
      ( tptpcol_3_81921(OBJ)
     => tptpcol_2_65537(OBJ) ) )).

% Cyc Assertion #1582501:
fof(ax3_808,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_etdlibfsueduthesesavailableetd_11152004_195710unrestricted02_las_mainpdf)),c_translation_33),c_basekb) )).

% Cyc Assertion #2365515:
fof(ax3_809,axiom,(
    ! [INS] :
      ( ( mtvisible(c_cyclistsmt)
        & bypassroute(INS) )
     => tptpofobject(INS,f_tptpquantityfn_4(n_163)) ) )).

fof(ax3_810,axiom,
    ( mtvisible(c_cyclistsmt)
   => relationallinstance(c_tptpofobject,c_bypassroute,f_tptpquantityfn_4(n_163)) )).

% Cyc Assertion #2173274:
fof(ax3_811,axiom,(
    genlmt(c_tptp_member585_mt,c_basekb) )).

% Cyc Assertion #2183906:
fof(ax3_812,axiom,(
    genlmt(c_tptp_member3243_mt,c_basekb) )).

% Cyc Assertion #2226305:
fof(ax3_813,axiom,
    ( mtvisible(c_tptp_member667_mt)
   => tptpcol_16_25985(c_tptptptpcol_16_25985) )).

% Cyc Assertion #1734376:
fof(ax3_814,axiom,(
    genls(c_battletank_m61a1,c_individual) )).

fof(ax3_815,axiom,(
    ! [OBJ] :
      ( battletank_m61a1(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1694321:
fof(ax3_816,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsandrabullockdearticlesdbvanityfair_sep95htm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1047598:
fof(ax3_817,axiom,(
    genlmt(c_cookinglingotemplatemt,c_basekb) )).

% Cyc Assertion #839867:
fof(ax3_818,axiom,(
    genls(c_diplomaticevent_statelevel,c_collection) )).

fof(ax3_819,axiom,(
    ! [OBJ] :
      ( diplomaticevent_statelevel(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #2171646:
fof(ax3_820,axiom,(
    genlmt(c_tptp_member178_mt,c_basekb) )).

% Cyc Assertion #879741:
fof(ax3_821,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_linktype_ks),c_basekb) )).

% Cyc Assertion #300608:
fof(ax3_822,axiom,(
    genlmt(c_rkfobservationap_scriptmt,c_basekb) )).

% Cyc Assertion #245666:
fof(ax3_823,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrnscompages4action96html)),c_translation_23),c_basekb) )).

% Cyc Assertion #2155285:
fof(ax3_824,axiom,(
    genlpreds(c_tptptypes_9_693,c_tptptypes_8_692) )).

fof(ax3_825,axiom,(
    ! [ARG1,ARG2] :
      ( tptptypes_9_693(ARG1,ARG2)
     => tptptypes_8_692(ARG1,ARG2) ) )).

% Cyc Assertion #285646:
fof(ax3_826,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnndbcompeople243000025168)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1281301:
fof(ax3_827,axiom,(
    genlmt(c_pq108_109mt,c_testvocabularymt) )).

% Cyc Assertion #2189315:
fof(ax3_828,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_tptp_spindleheadmt)
        & isa(TERM,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )
     => tptp_8_14(TERM,f_relationallexistsfn(TERM,c_tptp_8_14,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_15_20755)) ) )).

fof(ax3_829,axiom,
    ( mtvisible(c_tptp_spindleheadmt)
   => relationallexists(c_tptp_8_14,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_15_20755) )).

% Cyc Assertion #308094:
fof(ax3_830,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcmpageorgreport95html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1719079:
fof(ax3_831,axiom,(
    genlmt(c_wamt_evalinitial_p9,c_basekb) )).

% Cyc Assertion #777970:
fof(ax3_832,axiom,(
    genlmt(c_socreport_si_20030410_reportcontent,c_basekb) )).

% Cyc Assertion #495852:
fof(ax3_833,axiom,(
    genlmt(c_scripttemplatetestmt,c_basekb) )).

% Cyc Assertion #290788:
fof(ax3_834,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwejumpcutorgarchiveonlinessaysjc06folderearthqtowinfernohtml)),c_translation_31),c_basekb) )).

% Cyc Assertion #312087:
fof(ax3_835,axiom,(
    genlmt(c_scenariotestmt_6,c_basekb) )).

% Cyc Assertion #1361762:
fof(ax3_836,axiom,(
    genls(c_neutraltone,c_aspatialinformationstore) )).

fof(ax3_837,axiom,(
    ! [OBJ] :
      ( neutraltone(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1768615:
fof(ax3_838,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcolaconet1porthtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1611730:
fof(ax3_839,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsshopeasiercomfilesshopeasier_kathleen_kennedyhtml)),c_translation_31),c_basekb) )).

% Cyc Assertion #297065:
fof(ax3_840,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetundergroundground(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1619713:
fof(ax3_841,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_partiallytangible,c_objectsides,c_partiallytangible))
     => partiallytangible(OBJ) ) )).

fof(ax3_842,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_partiallytangible,c_objectsides,c_partiallytangible),c_partiallytangible) )).

fof(ax3_843,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnpartiallytangibleobjectsidespartiallytangible(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #292492:
fof(ax3_844,axiom,(
    genlmt(f_contextofpcwfn(c_thehobbit_novel),c_humansociallifemt) )).

% Cyc Assertion #305048:
fof(ax3_845,axiom,(
    genlmt(c_old_clothinggmt,c_basekb) )).

% Cyc Assertion #573282:
fof(ax3_846,axiom,(
    genls(c_pfizerantidepressantmarket,c_individual) )).

fof(ax3_847,axiom,(
    ! [OBJ] :
      ( pfizerantidepressantmarket(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2168312:
fof(ax3_848,axiom,(
    arg1isa(c_tptp_8_43,c_tptpcol_7_1030) )).

fof(ax3_849,axiom,(
    ! [ARG1,ARG2] :
      ( tptp_8_43(ARG1,ARG2)
     => tptpcol_7_1030(ARG1) ) )).

% Cyc Assertion #462054:
fof(ax3_850,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_27),c_basekb) )).

% Cyc Assertion #502099:
fof(ax3_851,axiom,(
    genls(c_m548_cargocarrier,c_artifact) )).

fof(ax3_852,axiom,(
    ! [OBJ] :
      ( m548_cargocarrier(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #414343:
fof(ax3_853,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbiblebyteorgbytephpbyte283)),c_translation_32),c_basekb) )).

% Cyc Assertion #487996:
fof(ax3_854,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_timblairspleenvillecomarchives007948php)),c_translation_7),c_basekb) )).

% Cyc Assertion #2183726:
fof(ax3_855,axiom,(
    genlmt(c_tptp_member3198_mt,c_basekb) )).

% Cyc Assertion #532207:
fof(ax3_856,axiom,(
    genls(c_boseeinsteincondensate_stateofmatter,c_partiallytangible) )).

fof(ax3_857,axiom,(
    ! [OBJ] :
      ( boseeinsteincondensate_stateofmatter(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1056790:
fof(ax3_858,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_8),c_basekb) )).

% Cyc Assertion #752168:
fof(ax3_859,axiom,(
    genlmt(c_cyccourseexercisesmt,c_basekb) )).

% Cyc Assertion #2173904:
fof(ax3_860,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member742_mt) )).

% Cyc Assertion #473879:
fof(ax3_861,axiom,(
    ! [OBJ] :
      ( collectionsubsetfnsuicideattackthesetofsui_1andeventoccursatsui_1israelstartsafterendingofsui_1yearfn2000(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #943375:
fof(ax3_862,axiom,(
    genlmt(c_assertionrerepresentationmt,c_basekb) )).

% Cyc Assertion #780745:
fof(ax3_863,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #375366:
fof(ax3_864,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetcurrencymobfncurrency(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1507515:
fof(ax3_865,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgreens_inorgarticle229phpsessid3641f5f711b0afdf34ae8268e87866d3)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185730:
fof(ax3_866,axiom,(
    genlmt(c_tptp_member3699_mt,c_basekb) )).

% Cyc Assertion #2176499:
fof(ax3_867,axiom,(
    genlmt(c_tptp_member1391_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #2174198:
fof(ax3_868,axiom,(
    genlmt(c_tptp_member816_mt,c_basekb) )).

% Cyc Assertion #1326003:
fof(ax3_869,axiom,(
    genlmt(c_temporalrelationsincoasmt,c_basekb) )).

% Cyc Assertion #1488209:
fof(ax3_870,axiom,(
    individual(c_wanica_districtsuriname) )).

% Cyc Assertion #2185978:
fof(ax3_871,axiom,(
    genlmt(c_tptp_member3761_mt,c_basekb) )).

% Cyc Assertion #2184654:
fof(ax3_872,axiom,(
    genlmt(c_tptp_member3430_mt,c_basekb) )).

% Cyc Assertion #949510:
fof(ax3_873,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwabcnetaunewenglandmornings)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #681880:
fof(ax3_874,axiom,(
    genlmt(c_elfspindleheadmt,c_basekb) )).

% Cyc Assertion #1723999:
fof(ax3_875,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_15),c_basekb) )).

% Cyc Assertion #1721231:
fof(ax3_876,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmbugcomdb343420)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182322:
fof(ax3_877,axiom,(
    genlmt(c_tptp_member2847_mt,c_basekb) )).

% Cyc Assertion #1521287:
fof(ax3_878,axiom,(
    genls(c_coastguardreserves,c_partiallytangible) )).

fof(ax3_879,axiom,(
    ! [OBJ] :
      ( coastguardreserves(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #517762:
fof(ax3_880,axiom,(
    genlmt(f_usermodelmtfn(c_cpof_user),c_basekb) )).

% Cyc Assertion #1460299:
fof(ax3_881,axiom,(
    genlmt(c_dialoguetrackingcollectormt,c_humansociallifemt) )).

% Cyc Assertion #2118053:
fof(ax3_882,axiom,(
    genls(c_tptpcol_14_118125,c_tptpcol_13_118117) )).

fof(ax3_883,axiom,(
    ! [OBJ] :
      ( tptpcol_14_118125(OBJ)
     => tptpcol_13_118117(OBJ) ) )).

% Cyc Assertion #1258449:
fof(ax3_884,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_28),c_basekb) )).

% Cyc Assertion #1802379:
fof(ax3_885,axiom,(
    genls(c_bomblet,c_individual) )).

fof(ax3_886,axiom,(
    ! [OBJ] :
      ( bomblet(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #373276:
fof(ax3_887,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomresearchtrianglelab4191millermillershtml)),c_translation_6),c_basekb) )).

% Cyc Assertion #1434465:
fof(ax3_888,axiom,(
    genlmt(c_websearchlexicalmt,c_basekb) )).

% Cyc Assertion #416640:
fof(ax3_889,axiom,(
    genls(c_csqltosqltranslationsyntaxdirective,c_aspatialinformationstore) )).

fof(ax3_890,axiom,(
    ! [OBJ] :
      ( csqltosqltranslationsyntaxdirective(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #2172638:
fof(ax3_891,axiom,(
    genlmt(c_tptp_member426_mt,c_basekb) )).

% Cyc Assertion #1609749:
fof(ax3_892,axiom,(
    genlmt(c_earthweathervocabularymt,c_basekb) )).

% Cyc Assertion #1039406:
fof(ax3_893,axiom,(
    genlmt(c_scenariotestmt_10,c_basekb) )).

% Cyc Assertion #637542:
fof(ax3_894,axiom,(
    genlmt(c_hpkbcrisismt,c_basekb) )).

% Cyc Assertion #2502810:
fof(ax3_895,axiom,
    ( mtvisible(c_tptpgeo_member7_mt)
   => inregion(c_geolocation_x53_y74,c_georegion_l4_x53_y74) )).

% Cyc Assertion #934683:
fof(ax3_896,axiom,(
    genls(c_bpvitemtype,c_collection) )).

fof(ax3_897,axiom,(
    ! [OBJ] :
      ( bpvitemtype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1642334:
fof(ax3_898,axiom,(
    genlmt(c_chemicalconstantdata_chemistrydomainmt,c_basekb) )).

% Cyc Assertion #1400362:
fof(ax3_899,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_3),c_basekb) )).

% Cyc Assertion #854842:
fof(ax3_900,axiom,
    ( mtvisible(c_computersoftwaredatamt)
   => configuringprogram(f_softwareversionfn(c_msregistryeditor,s_50021471)) )).

% Cyc Assertion #324172:
fof(ax3_901,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwisledegrandecomguestbookguestlistphpgensortbyalphalastsortbygradsortbymaidensortby)),c_translation_2),c_basekb) )).

% Cyc Assertion #2467068:
fof(ax3_902,axiom,(
    individual(c_georegion_l4_x37_y73) )).

% Cyc Assertion #358562:
fof(ax3_903,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvdbaroncomclassic_actresseseve_ardenhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1526545:
fof(ax3_904,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommrhtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #330874:
fof(ax3_905,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcomingsoonnetforumsarchiveindexphpt_3063_p_25html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1760464:
fof(ax3_906,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_systemofdevices))
     => partiallytangible(OBJ) ) )).

fof(ax3_907,axiom,(
    genls(f_groupfn(c_systemofdevices),c_partiallytangible) )).

fof(ax3_908,axiom,(
    ! [OBJ] :
      ( groupfnsystemofdevices(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #828189:
fof(ax3_909,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_crossoverfollowingcomdigitalragehtml)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173018:
fof(ax3_910,axiom,(
    genlmt(c_tptp_member521_mt,c_basekb) )).

% Cyc Assertion #1253040:
fof(ax3_911,axiom,(
    genls(c_record,c_individual) )).

fof(ax3_912,axiom,(
    ! [OBJ] :
      ( record(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1721932:
fof(ax3_913,axiom,(
    genls(c_coaunitbyorientation,c_collection) )).

fof(ax3_914,axiom,(
    ! [OBJ] :
      ( coaunitbyorientation(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1043706:
fof(ax3_915,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_softwareuserinterestmodelingrulesmt) )).

% Cyc Assertion #781128:
fof(ax3_916,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_musejhuedujournalscomputer_music_journalv026263dackpdf)),c_translation_33),c_basekb) )).

% Cyc Assertion #836935:
fof(ax3_917,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtnenetauabdaactsaccurhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1784738:
fof(ax3_918,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom2005_07_01_cycledog_archivehtml)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2477565:
fof(ax3_919,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x13_y3) )).

% Cyc Assertion #736376:
fof(ax3_920,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_israelipatrol,c_partiallytangible,s_3401f3f4_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_921,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_israelipatrol,c_partiallytangible,s_3401f3f4_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_922,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryisraelipatrolpartiallytangible3401f3f4_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1481079:
fof(ax3_923,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(c_akbuser,c_allotment_9,c_cycanalyticenvironment_theprogram),c_basekb) )).

% Cyc Assertion #662451:
fof(ax3_924,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_12),c_basekb) )).

% Cyc Assertion #2189587:
fof(ax3_925,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_tptp_member2110_mt)
        & executionbyfiringsquad(TERM) )
     => tptp_9_720(TERM,f_relationallexistsfn(TERM,c_tptp_9_720,c_executionbyfiringsquad,c_tptpcol_10_31619)) ) )).

fof(ax3_926,axiom,
    ( mtvisible(c_tptp_member2110_mt)
   => relationallexists(c_tptp_9_720,c_executionbyfiringsquad,c_tptpcol_10_31619) )).

% Cyc Assertion #2172582:
fof(ax3_927,axiom,(
    genlmt(c_tptp_member412_mt,c_basekb) )).

% Cyc Assertion #530971:
fof(ax3_928,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_kosovo_provinceserbia))
     => individual(OBJ) ) )).

fof(ax3_929,axiom,(
    genls(f_residentfn(c_kosovo_provinceserbia),c_individual) )).

fof(ax3_930,axiom,(
    ! [OBJ] :
      ( residentfnkosovo_provinceserbia(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2331377:
fof(ax3_931,axiom,(
    individual(c_tptptptpcol_16_128606) )).

% Cyc Assertion #1622431:
fof(ax3_932,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_binaryflixcommovieaspscopepid1208)),c_translation_29),c_basekb) )).

% Cyc Assertion #1313541:
fof(ax3_933,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmegaessayscomviewpaper83347html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2359224:
fof(ax3_934,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member235_mt)
        & ridgeline_topographical(INS) )
     => tptpofobject(INS,f_tptpquantityfn_13(n_468)) ) )).

fof(ax3_935,axiom,
    ( mtvisible(c_tptp_member235_mt)
   => relationallinstance(c_tptpofobject,c_ridgeline_topographical,f_tptpquantityfn_13(n_468)) )).

% Cyc Assertion #2223282:
fof(ax3_936,axiom,(
    isa(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_58,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )).

fof(ax3_937,axiom,(
    subcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_58) )).

% Cyc Assertion #957424:
fof(ax3_938,axiom,(
    genlmt(c_socreport_fbi_20030422a_reportcontent,c_basekb) )).

% Cyc Assertion #1625766:
fof(ax3_939,axiom,(
    genls(c_computationalobject,c_mathematicalorcomputationalthing) )).

fof(ax3_940,axiom,(
    ! [OBJ] :
      ( computationalobject(OBJ)
     => mathematicalorcomputationalthing(OBJ) ) )).

% Cyc Assertion #179011:
fof(ax3_941,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_trimethylphosphite,c_partiallytangible) )).

fof(ax3_942,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & trimethylphosphite(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2178610:
fof(ax3_943,axiom,(
    genlmt(c_tptp_member1919_mt,c_basekb) )).

% Cyc Assertion #2180870:
fof(ax3_944,axiom,(
    genlmt(c_tptp_member2484_mt,c_basekb) )).

% Cyc Assertion #1356691:
fof(ax3_945,axiom,(
    genls(c_temporallyextendedthing,c_intangibleindividual) )).

fof(ax3_946,axiom,(
    ! [OBJ] :
      ( temporallyextendedthing(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #1605432:
fof(ax3_947,axiom,(
    genls(c_commonsensetest_intentionalstatereasoning,c_individual) )).

fof(ax3_948,axiom,(
    ! [OBJ] :
      ( commonsensetest_intentionalstatereasoning(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #579080:
fof(ax3_949,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvillage_idiotsorgmovabletypearchives000087html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #968410:
fof(ax3_950,axiom,(
    genlmt(c_kee_infectiousdiseasetestmt,c_basekb) )).

% Cyc Assertion #2175338:
fof(ax3_951,axiom,(
    genlmt(c_tptp_member1101_mt,c_basekb) )).

% Cyc Assertion #448278:
fof(ax3_952,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_country_profile_lebanon),c_basekb) )).

% Cyc Assertion #2171942:
fof(ax3_953,axiom,(
    genlmt(c_tptp_member252_mt,c_basekb) )).

% Cyc Assertion #1663365:
fof(ax3_954,axiom,(
    genlmt(f_contentmtfn(c_gndb_fnc_recommend_action_ks),c_basekb) )).

% Cyc Assertion #1225801:
fof(ax3_955,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtfhtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1563655:
fof(ax3_956,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_star_ecentralcommoviesgradedetailsasppid877)),c_translation_0),c_basekb) )).

% Cyc Assertion #2176930:
fof(ax3_957,axiom,(
    genlmt(c_tptp_member1499_mt,c_basekb) )).

% Cyc Assertion #2180578:
fof(ax3_958,axiom,(
    genlmt(c_tptp_member2411_mt,c_basekb) )).

% Cyc Assertion #791196:
fof(ax3_959,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrobocoparchivecomboardviewtopicphpt2869highlightsid0351e83123ef0829b6c870cd033646a9)),c_translation_33),c_basekb) )).

% Cyc Assertion #1282659:
fof(ax3_960,axiom,(
    genlmt(c_geographymt,c_basekb) )).

% Cyc Assertion #1777581:
fof(ax3_961,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtopsynergycomfamousmichael_douglasasp)),c_translation_32),c_basekb) )).

% Cyc Assertion #591570:
fof(ax3_962,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilm_makerscoopcomcatalogchtml)),c_translation_30),c_basekb) )).

% Cyc Assertion #2174234:
fof(ax3_963,axiom,(
    genlmt(c_tptp_member825_mt,c_basekb) )).

% Cyc Assertion #609619:
fof(ax3_964,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_benzene,c_partiallytangible) )).

fof(ax3_965,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & benzene(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #352901:
fof(ax3_966,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleaderucomtheologyteenwitchcrafthtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #858591:
fof(ax3_967,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1293206:
fof(ax3_968,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbiblecasola_scriptura_pro_tradition_beloved_disciple_johnhtm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #986007:
fof(ax3_969,axiom,(
    genlmt(f_contextofpcwfn(c_terminator2_themovie),c_basekb) )).

% Cyc Assertion #1607541:
fof(ax3_970,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomjwgregsonpastorals1tim1_2htm)),c_translation_32),c_basekb) )).

% Cyc Assertion #1426775:
fof(ax3_971,axiom,(
    genlmt(c_reportsmt,c_basekb) )).

% Cyc Assertion #1026523:
fof(ax3_972,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom200508on_writinghtml)),c_translation_7),c_basekb) )).

% Cyc Assertion #1614293:
fof(ax3_973,axiom,(
    genlmt(f_contextofpcwfn(c_donotkeephandsinpocketwhileconversing),c_humansociallifemt) )).

% Cyc Assertion #1295386:
fof(ax3_974,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmatthewmcgeeorgpaultimehtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #581715:
fof(ax3_975,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikigeorge_smiley)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #232578:
fof(ax3_976,axiom,(
    genlmt(c_publiccyclistnotesmt,c_basekb) )).

% Cyc Assertion #1725361:
fof(ax3_977,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_infrastructureoffn(c_maritimeindustry))
     => partiallytangible(OBJ) ) )).

fof(ax3_978,axiom,(
    genls(f_infrastructureoffn(c_maritimeindustry),c_partiallytangible) )).

fof(ax3_979,axiom,(
    ! [OBJ] :
      ( infrastructureoffnmaritimeindustry(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1433065:
fof(ax3_980,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic2418494viewnew)),c_translation_2),c_basekb) )).

% Cyc Assertion #828919:
fof(ax3_981,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_quikonnexcomchannellinkphpid7418))) )).

% Cyc Assertion #2175206:
fof(ax3_982,axiom,(
    genlmt(c_tptp_member1068_mt,c_basekb) )).

% Cyc Assertion #612659:
fof(ax3_983,axiom,(
    genlmt(c_productlinkingmt,c_basekb) )).

% Cyc Assertion #1639314:
fof(ax3_984,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dailytitanfullertoneduissuesspring_9904_29newsdocumentarybecomeshtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2181002:
fof(ax3_985,axiom,(
    genlmt(c_tptp_member2517_mt,c_basekb) )).

% Cyc Assertion #1407990:
fof(ax3_986,axiom,(
    genls(c_furniturepiece,c_artifact) )).

fof(ax3_987,axiom,(
    ! [OBJ] :
      ( furniturepiece(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1012196:
fof(ax3_988,axiom,(
    genls(c_partdirectpartindirect,c_partiallytangible) )).

fof(ax3_989,axiom,(
    ! [OBJ] :
      ( partdirectpartindirect(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #252283:
fof(ax3_990,axiom,(
    genlmt(c_firemanclimbingladderimt,c_basekb) )).

% Cyc Assertion #1621672:
fof(ax3_991,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_officerinorganization,c_domainsofspecialization,c_artifact_communication))
     => partiallytangible(OBJ) ) )).

fof(ax3_992,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_officerinorganization,c_domainsofspecialization,c_artifact_communication),c_partiallytangible) )).

fof(ax3_993,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnofficerinorganizationdomainsofspecializationartifact_communication(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1371350:
fof(ax3_994,axiom,(
    genls(c_decoration,c_partiallytangible) )).

fof(ax3_995,axiom,(
    ! [OBJ] :
      ( decoration(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #583214:
fof(ax3_996,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwejumpcutorgarchiveonlinessaysjc06folderearthqtowinfernohtml)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1317389:
fof(ax3_997,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnaaedulocationhtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1178398:
fof(ax3_998,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_ww2moviefreebiecom_8567moviessome20folks20call20it20a20sling20bladeasb00005uo7f)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1408971:
fof(ax3_999,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmbugcomdb344728)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #307130:
fof(ax3_1000,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwskycomshowbizarticle050001_117309100html)),c_translation_33),c_basekb) )).

% Cyc Assertion #436541:
fof(ax3_1001,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcelebritybookscommerchant2merchantmvcscreenprodproduct_code55005category_codecelebrity_bio)),c_translation_2),c_basekb) )).

% Cyc Assertion #227750:
fof(ax3_1002,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwselohaarorgintrohtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #259089:
fof(ax3_1003,axiom,(
    genlmt(c_nimdtopicentitiesmt,c_basekb) )).

% Cyc Assertion #1609909:
fof(ax3_1004,axiom,(
    genls(c_softwaretestortypeversion,c_aspatialthing) )).

fof(ax3_1005,axiom,(
    ! [OBJ] :
      ( softwaretestortypeversion(OBJ)
     => aspatialthing(OBJ) ) )).

% Cyc Assertion #1485703:
fof(ax3_1006,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_rhetjournalnetcampbellpdf)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #841128:
fof(ax3_1007,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrainglecomcommunitywikiphpusergizzerpagejuly)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1560566:
fof(ax3_1008,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_freerepubliccomfocuskeywordkgenerationy)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1551120:
fof(ax3_1009,axiom,(
    genlmt(c_literarypeopledatamt,c_gregoriancalendarmt) )).

% Cyc Assertion #1654721:
fof(ax3_1010,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbible_researchercomoldlatinhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #831713:
fof(ax3_1011,axiom,(
    genlmt(c_pq129mt,c_testvocabularymt) )).

% Cyc Assertion #574157:
fof(ax3_1012,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1225847:
fof(ax3_1013,axiom,(
    genlmt(c_socreport_fbi_20030427a_reportcontent,c_basekb) )).

% Cyc Assertion #2179046:
fof(ax3_1014,axiom,(
    genlmt(c_tptp_member2028_mt,c_basekb) )).

% Cyc Assertion #2171582:
fof(ax3_1015,axiom,(
    genlmt(c_tptp_member162_mt,c_basekb) )).

% Cyc Assertion #391824:
fof(ax3_1016,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richlabontenetexonewsxtra3strange_quarkshtm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1573087:
fof(ax3_1017,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_15),c_machinelearningspindleheadmt) )).

% Cyc Assertion #980075:
fof(ax3_1018,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_15),c_basekb) )).

% Cyc Assertion #609181:
fof(ax3_1019,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwteenreadscomreviews0679751130asp)),c_translation_1),c_basekb) )).

% Cyc Assertion #945330:
fof(ax3_1020,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnprorgnewsspecialsbrown50)),c_translation_32),c_basekb) )).

% Cyc Assertion #1623665:
fof(ax3_1021,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplewwaynelindacanadaright)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #901708:
fof(ax3_1022,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(f_frequentperformerfn(c_activism),c_affiliatedwith,c_legislativeorganization))
     => individual(OBJ) ) )).

fof(ax3_1023,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(f_frequentperformerfn(c_activism),c_affiliatedwith,c_legislativeorganization),c_individual) )).

fof(ax3_1024,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnfrequentperformerfnactivismaffiliatedwithlegislativeorganization(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1319494:
fof(ax3_1025,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_terrorismtacticsmt)
        & isa(OBJ,f_groupfn(c_illegaldrug)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_1026,axiom,
    ( mtvisible(c_terrorismtacticsmt)
   => genls(f_groupfn(c_illegaldrug),c_partiallytangible) )).

fof(ax3_1027,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_terrorismtacticsmt)
        & groupfnillegaldrug(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1240526:
fof(ax3_1028,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordcageoffset0)),c_translation_33),c_basekb) )).

% Cyc Assertion #703799:
fof(ax3_1029,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplecftppypeoplecchristiedougcanadaright)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1117814:
fof(ax3_1030,axiom,(
    genlmt(f_contextofpcwfn(c_2001_aspaceodyssey_thebook),c_basekb) )).

% Cyc Assertion #1437726:
fof(ax3_1031,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_usamediamonitorsnetheadlinesmel_gibson_vs_abe_foxman_victory_for_first_amendment)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #724972:
fof(ax3_1032,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfirestreamnetviewtopicphpt14262side7998082faab8a2c158e4622e3556a55)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1068767:
fof(ax3_1033,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2186790:
fof(ax3_1034,axiom,(
    genlmt(c_tptp_member3964_mt,c_basekb) )).

% Cyc Assertion #1431542:
fof(ax3_1035,axiom,
    ( mtvisible(c_worldgeographymt)
   => state_geopolitical(c_kachinstateburma) )).

% Cyc Assertion #2176654:
fof(ax3_1036,axiom,(
    genlmt(c_tptp_member1430_mt,c_basekb) )).

% Cyc Assertion #1169561:
fof(ax3_1037,axiom,(
    genls(c_transparent,c_partiallytangible) )).

fof(ax3_1038,axiom,(
    ! [OBJ] :
      ( transparent(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1189046:
fof(ax3_1039,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhgtvcomhgtvrm_restoration_homes_areasarticle01797hgtv_3787_137528800html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #798008:
fof(ax3_1040,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_b0000cbl7avglance)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1596164:
fof(ax3_1041,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwflorida_locationcomtallahasseehtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2186114:
fof(ax3_1042,axiom,(
    genlmt(c_tptp_member3795_mt,c_basekb) )).

% Cyc Assertion #2185918:
fof(ax3_1043,axiom,(
    genlmt(c_tptp_member3746_mt,c_basekb) )).

% Cyc Assertion #1513502:
fof(ax3_1044,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineseatscomwill_smith_ticketsindexasp)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2177386:
fof(ax3_1045,axiom,(
    genlmt(c_tptp_member1613_mt,c_basekb) )).

% Cyc Assertion #1013629:
fof(ax3_1046,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_netessaysnetviewpaper8968html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #521220:
fof(ax3_1047,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweonlinecomnewsitems011107000htmlibd)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2410426:
fof(ax3_1048,axiom,
    ( mtvisible(c_cyclistsmt)
   => artsupplies(c_tptpartsupplies) )).

% Cyc Assertion #1701271:
fof(ax3_1049,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_person,c_owns,c_confectionery))
     => individual(OBJ) ) )).

fof(ax3_1050,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_person,c_owns,c_confectionery),c_individual) )).

fof(ax3_1051,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnpersonownsconfectionery(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1770890:
fof(ax3_1052,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpepperdineedubusinessservicesmail)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182234:
fof(ax3_1053,axiom,(
    genlmt(c_tptp_member2825_mt,c_basekb) )).

% Cyc Assertion #1419054:
fof(ax3_1054,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwatermarkofficeorgjourneyphpmonth12day3)),c_translation_33),c_basekb) )).

% Cyc Assertion #254238:
fof(ax3_1055,axiom,(
    genlmt(f_contentmodelforpegfn(f_thefn(c_linguisticexpressionpeg_completeutterance)),c_basekb) )).

% Cyc Assertion #1210794:
fof(ax3_1056,axiom,(
    genlmt(f_contentmtfn(c_fg1_feature_type_nga_xref_ks),c_basekb) )).

% Cyc Assertion #1189708:
fof(ax3_1057,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvillagevoicecomfilm0419davis5335720html)),c_translation_33),c_basekb) )).

% Cyc Assertion #242656:
fof(ax3_1058,axiom,(
    genls(c_smallbusiness,c_individual) )).

fof(ax3_1059,axiom,(
    ! [OBJ] :
      ( smallbusiness(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1784017:
fof(ax3_1060,axiom,(
    genlmt(c_terrorismlexicalmt,c_basekb) )).

% Cyc Assertion #703825:
fof(ax3_1061,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstartrekcomstartrekviewnewsarticle124354html)),c_translation_29),c_basekb) )).

% Cyc Assertion #1297969:
fof(ax3_1062,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnyfolkloreorgprogsfc99explorehtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1183421:
fof(ax3_1063,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_filmguardiancoukfeature_storyobserver041202538500html)),c_translation_15),c_basekb) )).

% Cyc Assertion #1131327:
fof(ax3_1064,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsunfictioncomforumsviewtopicphpp2067sida7d2a861b1818d3c520d2fb42967482d)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1747993:
fof(ax3_1065,axiom,(
    genlmt(c_productgvocabularymt,c_basekb) )).

% Cyc Assertion #309959:
fof(ax3_1066,axiom,(
    genls(c_watercourse,c_individual) )).

fof(ax3_1067,axiom,(
    ! [OBJ] :
      ( watercourse(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #812321:
fof(ax3_1068,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2440265:
fof(ax3_1069,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => tptpofobject(f_instancewithrelationtofn(c_airport_physical,c_airporthasiatacode,s_tlh),f_tptpquantityfn_21(n_170)) )).

% Cyc Assertion #948390:
fof(ax3_1070,axiom,(
    genlmt(f_contentmtfn(c_wordnet2_0_synsetverbframe_ks),c_basekb) )).

% Cyc Assertion #2177838:
fof(ax3_1071,axiom,(
    genlmt(c_tptp_member1726_mt,c_basekb) )).

% Cyc Assertion #1676862:
fof(ax3_1072,axiom,(
    genlmt(c_bbn_cde_definitionalassumptionsmt,c_basekb) )).

% Cyc Assertion #1215346:
fof(ax3_1073,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(f_subcollectionofusedforeventtypefn(c_airplane,c_surveillance_informationgatheringactivity),c_possessiverelation,c_israel))
     => individual(OBJ) ) )).

fof(ax3_1074,axiom,(
    genls(f_subcollectionofwithrelationfromfn(f_subcollectionofusedforeventtypefn(c_airplane,c_surveillance_informationgatheringactivity),c_possessiverelation,c_israel),c_individual) )).

fof(ax3_1075,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnsubcollectionofusedforeventtypefnairplanesurveillance_informationgatheringactivitypossessiverelationisrael(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #711297:
fof(ax3_1076,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1764792:
fof(ax3_1077,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoutherncteduorganizationshcr2002nonfictioncooperhtm)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1374589:
fof(ax3_1078,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_joyfulmusictripodcompage4html)),c_translation_20),c_basekb) )).

% Cyc Assertion #441875:
fof(ax3_1079,axiom,(
    genlmt(c_organizationblackboxmt,c_basekb) )).

% Cyc Assertion #1795236:
fof(ax3_1080,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviehabitcomessayscoffee_talk_04shtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1067823:
fof(ax3_1081,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwusatodaycomlifemoviesnews2003_02_04_chicago_xhtm)),c_translation_0),c_basekb) )).

% Cyc Assertion #761282:
fof(ax3_1082,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrainglecomcommunitywikiphpusergizzerpagejuly)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1053375:
fof(ax3_1083,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_bbc_news_world_edition_in_depth__iran_who_holds_the_power),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #714055:
fof(ax3_1084,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_danauccnauedurgb9)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #729672:
fof(ax3_1085,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombabusyroadway,c_actiononobject,s_3401a5d5_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_1086,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombabusyroadway,c_actiononobject,s_3401a5d5_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_1087,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarybombabusyroadwayactiononobject3401a5d5_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #209793:
fof(ax3_1088,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecomforumtmaspm62284mpage2)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #838182:
fof(ax3_1089,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcueduirmabout_irmself_study96_theoryhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #395103:
fof(ax3_1090,axiom,(
    genlmt(c_computerorganizationdatamt,c_unitedstatesgeographydualistmt) )).

% Cyc Assertion #1578342:
fof(ax3_1091,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_33),c_basekb) )).

% Cyc Assertion #2173966:
fof(ax3_1092,axiom,(
    genlmt(c_tptp_member758_mt,c_basekb) )).

% Cyc Assertion #2182882:
fof(ax3_1093,axiom,(
    genlmt(c_tptp_member2987_mt,c_basekb) )).

% Cyc Assertion #2179142:
fof(ax3_1094,axiom,(
    genlmt(c_tptp_member2052_mt,c_basekb) )).

% Cyc Assertion #1284438:
fof(ax3_1095,axiom,(
    genlmt(c_knowledgefragmentd13mt,c_basekb) )).

% Cyc Assertion #602946:
fof(ax3_1096,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmedical_librarynetsites_lupus_erythematosishtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #760671:
fof(ax3_1097,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleaderucomtheologyteenwitchcrafthtml)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #826220:
fof(ax3_1098,axiom,(
    genlmt(c_unitedkingdomsociallifemt,c_humansociallifemt) )).

% Cyc Assertion #2481165:
fof(ax3_1099,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x39_y66) )).

% Cyc Assertion #755973:
fof(ax3_1100,axiom,(
    genls(c_organicsoilregion,c_geographicalregion) )).

fof(ax3_1101,axiom,(
    ! [OBJ] :
      ( organicsoilregion(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #509082:
fof(ax3_1102,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleaderucomtheologyteenwitchcrafthtml)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176174:
fof(ax3_1103,axiom,(
    genlmt(c_tptp_member1310_mt,c_basekb) )).

% Cyc Assertion #237307:
fof(ax3_1104,axiom,(
    genlmt(c_nearearthssurfacevocabularymt,c_basekb) )).

% Cyc Assertion #1889319:
fof(ax3_1105,axiom,(
    genls(c_tptpcol_8_26629,c_tptpcol_7_26628) )).

fof(ax3_1106,axiom,(
    ! [OBJ] :
      ( tptpcol_8_26629(OBJ)
     => tptpcol_7_26628(OBJ) ) )).

% Cyc Assertion #510349:
fof(ax3_1107,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwteenreadscomreviews0679751130asp)),c_translation_31),c_basekb) )).

% Cyc Assertion #285802:
fof(ax3_1108,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwendervidualismcomagorastargate_1994htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1354715:
fof(ax3_1109,axiom,(
    genlmt(c_wamt_modevalinitial_p3,c_basekb) )).

% Cyc Assertion #451711:
fof(ax3_1110,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtheologyedub701htm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1849458:
fof(ax3_1111,axiom,(
    firstordercollection(c_tptpcol_14_10687) )).

% Cyc Assertion #438040:
fof(ax3_1112,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcbronlinecoukcompanyprofileaspguidd80ec5c2_6048_4b8f_b693_8a87ad230a64)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #503528:
fof(ax3_1113,axiom,(
    genlmt(c_jensexperimentalcolormt,c_basekb) )).

% Cyc Assertion #1000207:
fof(ax3_1114,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_simplewikipediaorgwikitallahassee_florida)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1707846:
fof(ax3_1115,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_commentcolostateeduindexasppagedisplay_articlearticle_id698743591)),c_translation_2),c_basekb) )).

% Cyc Assertion #1803402:
fof(ax3_1116,axiom,(
    genlmt(f_contextofpcwfn(c_fbireporttojudgegaleanoonamiabombing),c_basekb) )).

% Cyc Assertion #511802:
fof(ax3_1117,axiom,(
    genlmt(c_commonsensetestmt,c_unitedstatesgeographydualistmt) )).

% Cyc Assertion #2275545:
fof(ax3_1118,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_68) )).

% Cyc Assertion #950475:
fof(ax3_1119,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_screwthread,c_thing,s_3422e974_f4ed_11d9_9bea_0002b3a85b0b))
     => thing(OBJ) ) )).

fof(ax3_1120,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_screwthread,c_thing,s_3422e974_f4ed_11d9_9bea_0002b3a85b0b),c_thing) )).

fof(ax3_1121,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryscrewthreadthing3422e974_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1693633:
fof(ax3_1122,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoutherncteduorganizationshcr2002nonfictioncooperhtm)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #642770:
fof(ax3_1123,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_sports_boardsnetforumsshowthreadphpt24346)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #996657:
fof(ax3_1124,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtvcomhome_improvementbackstage_passepisode23169summaryhtml)),c_translation_24),c_basekb) )).

% Cyc Assertion #1394005:
fof(ax3_1125,axiom,(
    genlmt(c_performerperspectivemt,c_humansociallifemt) )).

% Cyc Assertion #1552591:
fof(ax3_1126,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetoctopusmalehumanfemalehuman(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #912082:
fof(ax3_1127,axiom,(
    genlmt(c_animateperformermt,c_basekb) )).

% Cyc Assertion #986965:
fof(ax3_1128,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmilechaicomjudaismrabbi_meir_kahanehtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #789800:
fof(ax3_1129,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #548050:
fof(ax3_1130,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_wwwchecklistscomchildrenhtml))) )).

% Cyc Assertion #496027:
fof(ax3_1131,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_timblairspleenvillecomarchives007948php)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1114356:
fof(ax3_1132,axiom,(
    genls(c_frontlighting,c_partiallytangible) )).

fof(ax3_1133,axiom,(
    ! [OBJ] :
      ( frontlighting(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #525982:
fof(ax3_1134,axiom,(
    genls(c_bqdp4,c_partiallytangible) )).

fof(ax3_1135,axiom,(
    ! [OBJ] :
      ( bqdp4(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1758331:
fof(ax3_1136,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwartmakerscombinghamtonhistoryhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #480494:
fof(ax3_1137,axiom,(
    genls(c_rolex_theproduct,c_individual) )).

fof(ax3_1138,axiom,(
    ! [OBJ] :
      ( rolex_theproduct(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1539201:
fof(ax3_1139,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwetycomhrpmediasmithhtm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2181854:
fof(ax3_1140,axiom,(
    genlmt(c_tptp_member2730_mt,c_basekb) )).

% Cyc Assertion #314869:
fof(ax3_1141,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_whos_who_in_syrias_leadership),c_ldscgeneralcollectormt) )).

% Cyc Assertion #949354:
fof(ax3_1142,axiom,(
    genlmt(c_wamt_evalinitial_p5a,c_basekb) )).

% Cyc Assertion #958384:
fof(ax3_1143,axiom,(
    genlmt(c_vegetationmapcodemt,c_basekb) )).

% Cyc Assertion #2182218:
fof(ax3_1144,axiom,(
    genlmt(c_tptp_member2821_mt,c_basekb) )).

% Cyc Assertion #1113825:
fof(ax3_1145,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwitvsorgoutsidelookinginfilmhtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1574006:
fof(ax3_1146,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrnscompages4action96html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1749830:
fof(ax3_1147,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_individual,c_possessiverelation,c_foodordrink))
     => individual(OBJ) ) )).

fof(ax3_1148,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_individual,c_possessiverelation,c_foodordrink),c_individual) )).

fof(ax3_1149,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnindividualpossessiverelationfoodordrink(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #587598:
fof(ax3_1150,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_16),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1263683:
fof(ax3_1151,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archiveaudioreviewcom050ef87e1aphp)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2174838:
fof(ax3_1152,axiom,(
    genlmt(c_tptp_member976_mt,c_basekb) )).

% Cyc Assertion #195571:
fof(ax3_1153,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomfilemelayurencanaenglishteller_of_taleshtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1193990:
fof(ax3_1154,axiom,(
    genlmt(c_unitedkennelclubmt,c_basekb) )).

% Cyc Assertion #1755263:
fof(ax3_1155,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_6),c_basekb) )).

% Cyc Assertion #2182778:
fof(ax3_1156,axiom,(
    genlmt(c_tptp_member2961_mt,c_basekb) )).

% Cyc Assertion #1477752:
fof(ax3_1157,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordtrueliesoffset0)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1525200:
fof(ax3_1158,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_detonateexplosivesinsidethesacrecoeurchurch,c_actiononobject,s_33f71e84_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_1159,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_detonateexplosivesinsidethesacrecoeurchurch,c_actiononobject,s_33f71e84_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_1160,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarydetonateexplosivesinsidethesacrecoeurchurchactiononobject33f71e84_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #548781:
fof(ax3_1161,axiom,(
    genlmt(c_pq236mt,c_testvocabularymt) )).

% Cyc Assertion #1195458:
fof(ax3_1162,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwesctodaycomnewsread3198)),c_translation_33),c_basekb) )).

% Cyc Assertion #1261736:
fof(ax3_1163,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwphoenixnewtimescomissues2005_12_22cultureart2html)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1008666:
fof(ax3_1164,axiom,(
    genlmt(c_moussaouiindictmentmt,c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #1750904:
fof(ax3_1165,axiom,(
    genlmt(c_mysenlgenerationmt_jonc,c_basekb) )).

% Cyc Assertion #771615:
fof(ax3_1166,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdelfininternationalcom3dvd6htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1379759:
fof(ax3_1167,axiom,(
    genlmt(c_nonusprofessionalsportsmt,c_basekb) )).

% Cyc Assertion #1023528:
fof(ax3_1168,axiom,(
    genls(c_oxbowlake,c_partiallytangible) )).

fof(ax3_1169,axiom,(
    ! [OBJ] :
      ( oxbowlake(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #212854:
fof(ax3_1170,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstudentsoftheworldinfositesmisc1403php)),c_translation_2),c_basekb) )).

% Cyc Assertion #1059950:
fof(ax3_1171,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinfopleasecomipeaa0761438html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1167364:
fof(ax3_1172,axiom,(
    genls(c_replacementoption,c_individual) )).

fof(ax3_1173,axiom,(
    ! [OBJ] :
      ( replacementoption(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1746260:
fof(ax3_1174,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #227126:
fof(ax3_1175,axiom,(
    genlmt(c_humanpreferencesmt,c_basekb) )).

% Cyc Assertion #199409:
fof(ax3_1176,axiom,(
    genls(c_transportingammunition,c_individual) )).

fof(ax3_1177,axiom,(
    ! [OBJ] :
      ( transportingammunition(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #764798:
fof(ax3_1178,axiom,(
    applicationcontext(c_sidap_fwdrulesmt) )).

% Cyc Assertion #1269539:
fof(ax3_1179,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_moisesefaradorgbelsefphpid398)),c_translation_2),c_basekb) )).

% Cyc Assertion #1130402:
fof(ax3_1180,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_ww2moviefreebiecom_8567moviessome20folks20call20it20a20sling20bladeasb00005uo7f)),c_translation_33),c_basekb) )).

% Cyc Assertion #683601:
fof(ax3_1181,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilm_makerscoopcomcatalogchtml)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #339942:
fof(ax3_1182,axiom,(
    arg2isa(c_connectedperpendicularlyto,c_solidtangiblething) )).

fof(ax3_1183,axiom,(
    ! [ARG1,ARG2] :
      ( connectedperpendicularlyto(ARG1,ARG2)
     => solidtangiblething(ARG2) ) )).

% Cyc Assertion #204438:
fof(ax3_1184,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwterminalcitycaindexphpoptioncom_contenttaskviewid100itemid33)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #975634:
fof(ax3_1185,axiom,(
    genls(c_attributecleanupconstant,c_thing) )).

fof(ax3_1186,axiom,(
    ! [OBJ] :
      ( attributecleanupconstant(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #747260:
fof(ax3_1187,axiom,(
    ! [OBJ] :
      ( causingfncollectionunionfnthesetexperiencingemotionfnhappinessexperiencingemotionfnsatisfaction(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1045728:
fof(ax3_1188,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_scoopdiamondgalleriescomscoop_articleaspai7620si123)),c_translation_0),c_basekb) )).

% Cyc Assertion #1237863:
fof(ax3_1189,axiom,(
    lexicalword(f_humanfemalegivennamefn(s_myrt)) )).

% Cyc Assertion #641023:
fof(ax3_1190,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_collegehmcocomhistoryreaderscompgahffhtmlff_103400_jonesjameseahtm)),c_translation_16),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1338285:
fof(ax3_1191,axiom,(
    genlmt(c_udstheorymt,c_basekb) )).

% Cyc Assertion #2056994:
fof(ax3_1192,axiom,(
    genls(c_tptpcol_10_93700,c_tptpcol_9_93699) )).

fof(ax3_1193,axiom,(
    ! [OBJ] :
      ( tptpcol_10_93700(OBJ)
     => tptpcol_9_93699(OBJ) ) )).

% Cyc Assertion #314945:
fof(ax3_1194,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_29),c_basekb) )).

% Cyc Assertion #752649:
fof(ax3_1195,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_biologyvocabularymt)
        & isa(OBJ,f_groupfn(c_cellpart)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_1196,axiom,
    ( mtvisible(c_biologyvocabularymt)
   => genls(f_groupfn(c_cellpart),c_partiallytangible) )).

fof(ax3_1197,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_biologyvocabularymt)
        & groupfncellpart(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2183066:
fof(ax3_1198,axiom,(
    genlmt(c_tptp_member3033_mt,c_basekb) )).

% Cyc Assertion #1158322:
fof(ax3_1199,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetalgerianpersonpalestinianperson(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #828601:
fof(ax3_1200,axiom,(
    genls(c_closeassaultunit_militaryspecialty,c_individual) )).

fof(ax3_1201,axiom,(
    ! [OBJ] :
      ( closeassaultunit_militaryspecialty(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1182694:
fof(ax3_1202,axiom,(
    genlmt(f_contextofpcwfn(c_nofirststrike),c_basekb) )).

% Cyc Assertion #2178750:
fof(ax3_1203,axiom,(
    genlmt(c_tptp_member1954_mt,c_basekb) )).

% Cyc Assertion #1890054:
fof(ax3_1204,axiom,(
    genls(c_tptpcol_15_26925,c_tptpcol_14_26921) )).

fof(ax3_1205,axiom,(
    ! [OBJ] :
      ( tptpcol_15_26925(OBJ)
     => tptpcol_14_26921(OBJ) ) )).

% Cyc Assertion #172880:
fof(ax3_1206,axiom,(
    genlmt(c_animalphysiologymt,c_basekb) )).

% Cyc Assertion #960866:
fof(ax3_1207,axiom,(
    genlmt(c_myseparsingmt_hugojedermann,c_basekb) )).

% Cyc Assertion #763654:
fof(ax3_1208,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_wanica_districtsuriname) )).

% Cyc Assertion #2150048:
fof(ax3_1209,axiom,(
    genls(c_tptpcol_16_130924,c_tptpcol_15_130923) )).

fof(ax3_1210,axiom,(
    ! [OBJ] :
      ( tptpcol_16_130924(OBJ)
     => tptpcol_15_130923(OBJ) ) )).

% Cyc Assertion #2186462:
fof(ax3_1211,axiom,(
    genlmt(c_tptp_member3882_mt,c_basekb) )).

% Cyc Assertion #1144912:
fof(ax3_1212,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtvcombackstage_passepisode23169triviahtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1425258:
fof(ax3_1213,axiom,(
    genlmt(c_test102mt,c_basekb) )).

% Cyc Assertion #1244143:
fof(ax3_1214,axiom,(
    genls(c_trichloroethylene,c_partiallytangible) )).

fof(ax3_1215,axiom,(
    ! [OBJ] :
      ( trichloroethylene(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2175250:
fof(ax3_1216,axiom,(
    genlmt(c_tptp_member1079_mt,c_basekb) )).

% Cyc Assertion #2172006:
fof(ax3_1217,axiom,(
    genlmt(c_tptp_member268_mt,c_basekb) )).

% Cyc Assertion #1142391:
fof(ax3_1218,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_ww2moviefreebiecom_8567moviessome20folks20call20it20a20sling20bladeasb00005uo7f)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #878055:
fof(ax3_1219,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_diagonallyorgforumviewtopicphpp98891sid30402306706f8b17405a36ee5f5f6846)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #1578534:
fof(ax3_1220,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnytimescombooksfirstssteyn_broadwayhtml)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #881354:
fof(ax3_1221,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsmartfellowspresscomsmokinggunballgame_1htmlhtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #476379:
fof(ax3_1222,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetsurfacelinesegmentpoint(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2494561:
fof(ax3_1223,axiom,
    ( mtvisible(c_tptpgeo_member1_mt)
   => geographicalsubregions(c_georegion_l3_x11_y2,c_georegion_l4_x33_y6) )).

% Cyc Assertion #324417:
fof(ax3_1224,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_groupsmsncomthespiritdetectivesayuyuhakushorpgsarayashikihighmsnwactionget_messagemview0id_message17012lastmodified4675527165630904879)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2221601:
fof(ax3_1225,axiom,(
    genlmt(c_tptpnadvicefncunnilingus,c_basekb) )).

% Cyc Assertion #616849:
fof(ax3_1226,axiom,(
    genls(c_geographicalregion,c_spatiallyboundedthing) )).

fof(ax3_1227,axiom,(
    ! [OBJ] :
      ( geographicalregion(OBJ)
     => spatiallyboundedthing(OBJ) ) )).

% Cyc Assertion #2189688:
fof(ax3_1228,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => tptptypes_9_693(f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma),c_tptpcol_16_26939) )).

% Cyc Assertion #2185922:
fof(ax3_1229,axiom,(
    genlmt(c_tptp_member3747_mt,c_basekb) )).

% Cyc Assertion #1732125:
fof(ax3_1230,axiom,
    ( mtvisible(c_universitydatamt)
   => college(c_westfieldstatecollege) )).

% Cyc Assertion #2177142:
fof(ax3_1231,axiom,(
    genlmt(c_tptp_member1552_mt,c_basekb) )).

% Cyc Assertion #512465:
fof(ax3_1232,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjudygarlandoffset0)),c_translation_31),c_basekb) )).

% Cyc Assertion #1253240:
fof(ax3_1233,axiom,(
    arg2isa(c_both,c_setorcollection) )).

fof(ax3_1234,axiom,(
    ! [ARG1,ARG2] :
      ( both(ARG1,ARG2)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #2179958:
fof(ax3_1235,axiom,(
    genlmt(c_tptp_member2256_mt,c_basekb) )).

% Cyc Assertion #621600:
fof(ax3_1236,axiom,(
    genlmt(f_contentmtfn(c_testlanguagespoken_fht),c_cyclistsmt) )).

% Cyc Assertion #646338:
fof(ax3_1237,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_deadanimal))
     => partiallytangible(OBJ) ) )).

fof(ax3_1238,axiom,(
    genls(f_groupfn(c_deadanimal),c_partiallytangible) )).

fof(ax3_1239,axiom,(
    ! [OBJ] :
      ( groupfndeadanimal(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1103756:
fof(ax3_1240,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #495476:
fof(ax3_1241,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_patternwithinpatternwithinpattern,c_individual,s_33f37503_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_1242,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_patternwithinpatternwithinpattern,c_individual,s_33f37503_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_1243,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarypatternwithinpatternwithinpatternindividual33f37503_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #600621:
fof(ax3_1244,axiom,(
    genls(c_threateningtodokilling_biologicalsubeventspoisoning,c_individual) )).

fof(ax3_1245,axiom,(
    ! [OBJ] :
      ( threateningtodokilling_biologicalsubeventspoisoning(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #444355:
fof(ax3_1246,axiom,(
    genlmt(f_contentmtfn(c_gndb_feature_ks),c_basekb) )).

% Cyc Assertion #1614159:
fof(ax3_1247,axiom,(
    genls(c_path_spatial,c_enduringthing_localized) )).

fof(ax3_1248,axiom,(
    ! [OBJ] :
      ( path_spatial(OBJ)
     => enduringthing_localized(OBJ) ) )).

% Cyc Assertion #354443:
fof(ax3_1249,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvdplayerreviewsnetitemsb0000cbl7a)),c_translation_30),c_basekb) )).

% Cyc Assertion #1322285:
fof(ax3_1250,axiom,(
    genlmt(c_islamicradicalism_growingrisksmt,c_hpkbvocabmt) )).

% Cyc Assertion #1675860:
fof(ax3_1251,axiom,(
    genlmt(c_terrorismthreatinmiddleeastmt,c_basekb) )).

% Cyc Assertion #1397681:
fof(ax3_1252,axiom,(
    genlmt(c_temporarylexicalassertions_wordnetimportmt,c_basekb) )).

% Cyc Assertion #1014973:
fof(ax3_1253,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmilechaicomjudaismrabbi_meir_kahanehtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1025907:
fof(ax3_1254,axiom,
    ( mtvisible(c_namelexicalmt)
   => humansurname(f_namefn(s_moll)) )).

% Cyc Assertion #752526:
fof(ax3_1255,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentfilm4009157stm)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #933871:
fof(ax3_1256,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcueduirmabout_irmself_study96_theoryhtml)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1262542:
fof(ax3_1257,axiom,(
    genlmt(c_massmediadatamt,c_ethnicgroupsmt) )).

% Cyc Assertion #2173478:
fof(ax3_1258,axiom,(
    genlmt(c_tptp_member636_mt,c_basekb) )).

% Cyc Assertion #2492894:
fof(ax3_1259,axiom,
    ( mtvisible(c_tptpgeo_member3_mt)
   => geographicalsubregions(c_georegion_l3_x4_y13,c_georegion_l4_x12_y40) )).

% Cyc Assertion #822796:
fof(ax3_1260,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweonlinecomnewsitems011248700html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #730556:
fof(ax3_1261,axiom,(
    genlmt(c_butler_fasthead_querymt,c_machinelearningspindleheadmt) )).

% Cyc Assertion #1054675:
fof(ax3_1262,axiom,(
    genls(c_cycinternaltask_researchcyc_project_the_68,c_individual) )).

fof(ax3_1263,axiom,(
    ! [OBJ] :
      ( cycinternaltask_researchcyc_project_the_68(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1273806:
fof(ax3_1264,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineseatscomwill_smith_ticketsindexasp)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #759485:
fof(ax3_1265,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjoanallenoffset0)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2186122:
fof(ax3_1266,axiom,(
    genlmt(c_tptp_member3797_mt,c_basekb) )).

% Cyc Assertion #319450:
fof(ax3_1267,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadianwestern_guard_partyftppyorgscanadianwestern_guard_partycanadaright)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175558:
fof(ax3_1268,axiom,(
    genlmt(c_tptp_member1156_mt,c_basekb) )).

% Cyc Assertion #1726723:
fof(ax3_1269,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_25),c_basekb) )).

% Cyc Assertion #1554606:
fof(ax3_1270,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_binaryflixcommovieaspscopepid1208)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2181268:
fof(ax3_1271,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member2583_mt) )).

% Cyc Assertion #269868:
fof(ax3_1272,axiom,(
    genls(c_cruciformobject,c_partiallytangible) )).

fof(ax3_1273,axiom,(
    ! [OBJ] :
      ( cruciformobject(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #713766:
fof(ax3_1274,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_21),c_machinelearningspindleheadmt) )).

% Cyc Assertion #769422:
fof(ax3_1275,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_hariri_investigation_key_figures),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #2181578:
fof(ax3_1276,axiom,(
    genlmt(c_tptp_member2661_mt,c_basekb) )).

% Cyc Assertion #944754:
fof(ax3_1277,axiom,(
    genls(c_othercardiovascularagents,c_individual) )).

fof(ax3_1278,axiom,(
    ! [OBJ] :
      ( othercardiovascularagents(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1457752:
fof(ax3_1279,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnytimescombooksfirstssteyn_broadwayhtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #419196:
fof(ax3_1280,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0870541811vglance)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1947413:
fof(ax3_1281,axiom,(
    firstordercollection(c_tptpcol_15_49869) )).

% Cyc Assertion #703494:
fof(ax3_1282,axiom,(
    genls(c_bridgeunit_militaryspecialty,c_individual) )).

fof(ax3_1283,axiom,(
    ! [OBJ] :
      ( bridgeunit_militaryspecialty(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1710787:
fof(ax3_1284,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstpuheduvol6772shobizshobiz_indexhtml)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1090591:
fof(ax3_1285,axiom,(
    ! [OBJ] :
      ( collectionsubsetfntechstockthesetofstockthereexistsinvestingthereexistsdateandtemporallysubsumestimeintervalinclusivefndecadefn199earlypartfnyearfn2000datedateofeventinvestingdateobjectpaidforinvestingstock(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #306768:
fof(ax3_1286,axiom,(
    genls(c_industrytakeover,c_individual) )).

fof(ax3_1287,axiom,(
    ! [OBJ] :
      ( industrytakeover(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #910042:
fof(ax3_1288,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmtsuedusocworkfrostgodmohicanshtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1002793:
fof(ax3_1289,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_memberstripodcommarzullotolivierhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2095393:
fof(ax3_1290,axiom,(
    genls(c_tptpcol_8_109059,c_tptpcol_7_108547) )).

fof(ax3_1291,axiom,(
    ! [OBJ] :
      ( tptpcol_8_109059(OBJ)
     => tptpcol_7_108547(OBJ) ) )).

% Cyc Assertion #912550:
fof(ax3_1292,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #2184566:
fof(ax3_1293,axiom,(
    genlmt(c_tptp_member3408_mt,c_basekb) )).

% Cyc Assertion #342739:
fof(ax3_1294,axiom,(
    arg2isa(c_subcollectionofusedfortypefn,c_collection) )).

% Cyc Assertion #2173778:
fof(ax3_1295,axiom,(
    genlmt(c_tptp_member711_mt,c_basekb) )).

% Cyc Assertion #1158372:
fof(ax3_1296,axiom,(
    genlmt(c_nooescapearchitecturemt,c_ethnicgroupsvocabularymt) )).

% Cyc Assertion #1068518:
fof(ax3_1297,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_18),c_basekb) )).

% Cyc Assertion #343187:
fof(ax3_1298,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwejumpcutorgarchiveonlinessaysjc06folderearthqtowinfernohtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #325573:
fof(ax3_1299,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_724129227celebritiesrichardgeretriviatest_answersshtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1791393:
fof(ax3_1300,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwyouthvoteorgnewsnewsdetailcfmnewsid544)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #561890:
fof(ax3_1301,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkimmccallorgwritingspnhpnh_abstracthtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #200612:
fof(ax3_1302,axiom,(
    genlmt(c_externalontologyprojectsmt,c_basekb) )).

% Cyc Assertion #601089:
fof(ax3_1303,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbbccoukcoventrycontentarticles20041118theatre_review_silas_marner_at_talisman_featureshtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1762777:
fof(ax3_1304,axiom,(
    genlmt(f_usermodelmtfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_jimjefferson)),c_basekb) )).

% Cyc Assertion #713268:
fof(ax3_1305,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_amazing,c_thing,s_340af4a1_f4ed_11d9_9bea_0002b3a85b0b))
     => thing(OBJ) ) )).

fof(ax3_1306,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_amazing,c_thing,s_340af4a1_f4ed_11d9_9bea_0002b3a85b0b),c_thing) )).

fof(ax3_1307,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryamazingthing340af4a1_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #918556:
fof(ax3_1308,axiom,(
    genlmt(c_imdb_querymt,c_basekb) )).

% Cyc Assertion #1038173:
fof(ax3_1309,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1645647:
fof(ax3_1310,axiom,(
    genlmt(c_agent_specificfactsheet_arabianliberationarmymt,c_basekb) )).

% Cyc Assertion #2171138:
fof(ax3_1311,axiom,(
    genlmt(c_tptp_member51_mt,c_basekb) )).

% Cyc Assertion #2261910:
fof(ax3_1312,axiom,
    ( mtvisible(c_tptp_member3077_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_45) )).

% Cyc Assertion #596989:
fof(ax3_1313,axiom,(
    genls(c_recoillesslauncher_m40,c_individual) )).

fof(ax3_1314,axiom,(
    ! [OBJ] :
      ( recoillesslauncher_m40(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #674992:
fof(ax3_1315,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgfeature_5604)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #592617:
fof(ax3_1316,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentfilm4009157stm)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1162581:
fof(ax3_1317,axiom,(
    genlmt(f_contextofpcwfn(c_unitedstatesmaritimelaw_coc),c_humansociallifemt) )).

% Cyc Assertion #751815:
fof(ax3_1318,axiom,(
    genlmt(c_botanyvocabularymt,c_basekb) )).

% Cyc Assertion #494806:
fof(ax3_1319,axiom,(
    individual(f_urlreferentfn(f_urlfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_qa3874is_200001ai_n8898111)))) )).

% Cyc Assertion #934718:
fof(ax3_1320,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcliffsnotescomwileycdalitnoteid_39pagenum_7html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1701963:
fof(ax3_1321,axiom,(
    genls(c_historicalpossibilitymicrotheory,c_microtheory) )).

fof(ax3_1322,axiom,(
    ! [OBJ] :
      ( historicalpossibilitymicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #1485660:
fof(ax3_1323,axiom,(
    genlmt(c_timehasnobeginningmt,c_basekb) )).

% Cyc Assertion #1524896:
fof(ax3_1324,axiom,(
    genls(c_atemporalmicrotheory,c_microtheory) )).

fof(ax3_1325,axiom,(
    ! [OBJ] :
      ( atemporalmicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #2478009:
fof(ax3_1326,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x0_y69) )).

% Cyc Assertion #395678:
fof(ax3_1327,axiom,(
    logicalfield(f_logicalfieldfn(c_cycorpbugzillacreate_ls,c_characterstring,n_1)) )).

% Cyc Assertion #876896:
fof(ax3_1328,axiom,(
    genls(c_partofbuilding_abovegroundfloor,c_partiallytangible) )).

fof(ax3_1329,axiom,(
    ! [OBJ] :
      ( partofbuilding_abovegroundfloor(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1246369:
fof(ax3_1330,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom2005_08_01_visionsofparadise_archivehtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2177734:
fof(ax3_1331,axiom,(
    genlmt(c_tptp_member1700_mt,c_basekb) )).

% Cyc Assertion #458077:
fof(ax3_1332,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomrealmsofwisdomfantasyfantasy1html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2477486:
fof(ax3_1333,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x10_y5) )).

% Cyc Assertion #2172930:
fof(ax3_1334,axiom,(
    genlmt(c_tptp_member499_mt,c_basekb) )).

% Cyc Assertion #1548915:
fof(ax3_1335,axiom,(
    genls(c_manmadething,c_individual) )).

fof(ax3_1336,axiom,(
    ! [OBJ] :
      ( manmadething(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2176138:
fof(ax3_1337,axiom,(
    genlmt(c_tptp_member1301_mt,c_basekb) )).

% Cyc Assertion #360884:
fof(ax3_1338,axiom,(
    genls(c_offeringtoprecisifyapredicateinuia,c_individual) )).

fof(ax3_1339,axiom,(
    ! [OBJ] :
      ( offeringtoprecisifyapredicateinuia(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #866442:
fof(ax3_1340,axiom,(
    genlmt(c_eventpredicatetestmt,c_cyclistsmt) )).

% Cyc Assertion #1613427:
fof(ax3_1341,axiom,(
    genls(c_halochemistrykts_appractice_princetonreviewexamtwo,c_individual) )).

fof(ax3_1342,axiom,(
    ! [OBJ] :
      ( halochemistrykts_appractice_princetonreviewexamtwo(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2178630:
fof(ax3_1343,axiom,(
    genlmt(c_tptp_member1924_mt,c_basekb) )).

% Cyc Assertion #1035331:
fof(ax3_1344,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcenedracomtpdavidlynch2htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #495964:
fof(ax3_1345,axiom,(
    genls(c_concealmentprovidingterrain,c_geographicalregion) )).

fof(ax3_1346,axiom,(
    ! [OBJ] :
      ( concealmentprovidingterrain(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #2185470:
fof(ax3_1347,axiom,(
    genlmt(c_tptp_member3634_mt,c_basekb) )).

% Cyc Assertion #1126508:
fof(ax3_1348,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2174662:
fof(ax3_1349,axiom,(
    genlmt(c_tptp_member932_mt,c_basekb) )).

% Cyc Assertion #550095:
fof(ax3_1350,axiom,
    ( mtvisible(c_ciaworldfactbook1995mt)
   => genls(c_lumber,c_partiallytangible) )).

fof(ax3_1351,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_ciaworldfactbook1995mt)
        & lumber(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #242259:
fof(ax3_1352,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_meaninginsystemfn(c_sensus_information1997,s_misc_stuff))
     => thing(OBJ) ) )).

fof(ax3_1353,axiom,(
    genls(f_meaninginsystemfn(c_sensus_information1997,s_misc_stuff),c_thing) )).

fof(ax3_1354,axiom,(
    ! [OBJ] :
      ( meaninginsystemfnsensus_information1997misc_stuff(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #287475:
fof(ax3_1355,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbelfastislamiccentreorgukvisitorsguidehtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #777028:
fof(ax3_1356,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwagabuscouktitusnoteshtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1701558:
fof(ax3_1357,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom2005_07_01_cycledog_archivehtml)),c_translation_30),c_basekb) )).

% Cyc Assertion #1168695:
fof(ax3_1358,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmiamifilmfestivalcomjurorsasp)),c_translation_0),c_basekb) )).

% Cyc Assertion #540961:
fof(ax3_1359,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #1331695:
fof(ax3_1360,axiom,(
    genlmt(c_cycarchitecture_intermediatemt,c_basekb) )).

% Cyc Assertion #198456:
fof(ax3_1361,axiom,(
    genlmt(c_ctc_gketestmt,c_basekb) )).

% Cyc Assertion #1521588:
fof(ax3_1362,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstpuheduvol6772shobizshobiz_indexhtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #715461:
fof(ax3_1363,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_legendstypepadcomliving_with_legends_the_h200507cult_fictionhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #2184946:
fof(ax3_1364,axiom,(
    genlmt(c_tptp_member3503_mt,c_basekb) )).

% Cyc Assertion #623451:
fof(ax3_1365,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_17),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1445063:
fof(ax3_1366,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcambridgeorgukcataloguecatalogueaspisbn0521831423)),c_translation_32),c_basekb) )).

% Cyc Assertion #1286267:
fof(ax3_1367,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_irishrepublic))
     => individual(OBJ) ) )).

fof(ax3_1368,axiom,(
    genls(f_residentfn(c_irishrepublic),c_individual) )).

fof(ax3_1369,axiom,(
    ! [OBJ] :
      ( residentfnirishrepublic(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2182090:
fof(ax3_1370,axiom,(
    genlmt(c_tptp_member2789_mt,c_basekb) )).

% Cyc Assertion #1802105:
fof(ax3_1371,axiom,(
    genlmt(c_persiangulfoilexportfactsheetmt,c_basekb) )).

% Cyc Assertion #1747025:
fof(ax3_1372,axiom,(
    genls(c_ballisticmissile_oghab,c_individual) )).

fof(ax3_1373,axiom,(
    ! [OBJ] :
      ( ballisticmissile_oghab(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #750563:
fof(ax3_1374,axiom,(
    genls(c_comparativemodifiertype,c_thing) )).

fof(ax3_1375,axiom,(
    ! [OBJ] :
      ( comparativemodifiertype(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2177598:
fof(ax3_1376,axiom,(
    genlmt(c_tptp_member1666_mt,c_basekb) )).

% Cyc Assertion #1802804:
fof(ax3_1377,axiom,(
    genls(c_concealmentfromaerialdetection_good,c_geographicalregion) )).

fof(ax3_1378,axiom,(
    ! [OBJ] :
      ( concealmentfromaerialdetection_good(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #976286:
fof(ax3_1379,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikitum)),c_translation_6),c_basekb) )).

% Cyc Assertion #745858:
fof(ax3_1380,axiom,(
    genlmt(c_salutereportstestmt,c_basekb) )).

% Cyc Assertion #926214:
fof(ax3_1381,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtfhtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #1599570:
fof(ax3_1382,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwuniversitysportcaestory_detailcfmid6284)),c_translation_0),c_basekb) )).

% Cyc Assertion #980697:
fof(ax3_1383,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_artsedgekennedy_centerorgcontent3498)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #694431:
fof(ax3_1384,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwggggcombestdvdabesdcjaxfvahtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #993021:
fof(ax3_1385,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwteachingafricacomcustomaspid6813page5shopperid)),c_translation_33),c_basekb) )).

% Cyc Assertion #1601781:
fof(ax3_1386,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreennameforumcomforumsindexphpshowtopic7873viewnew)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #662021:
fof(ax3_1387,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_naturalobstacle,c_obstacleblocks,c_travelroute_air))
     => individual(OBJ) ) )).

fof(ax3_1388,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_naturalobstacle,c_obstacleblocks,c_travelroute_air),c_individual) )).

fof(ax3_1389,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnnaturalobstacleobstacleblockstravelroute_air(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #266347:
fof(ax3_1390,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_30),c_basekb) )).

% Cyc Assertion #1399086:
fof(ax3_1391,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richmondthenandnowcomfamous_people_richmond_4html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #722385:
fof(ax3_1392,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_testnaspetersonscomgradchannelcodeiddasporderlinenum447422_1inunid30718typevcprogramvcsponsor1majunit34479)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2512506:
fof(ax3_1393,axiom,
    ( mtvisible(c_tptpgeo_member1_mt)
   => borderson(c_georegion_l4_x39_y23,c_georegion_l4_x39_y24) )).

% Cyc Assertion #357878:
fof(ax3_1394,axiom,(
    arg2isa(c_relativelyfew,c_setorcollection) )).

fof(ax3_1395,axiom,(
    ! [ARG1,ARG2] :
      ( relativelyfew(ARG1,ARG2)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #1082838:
fof(ax3_1396,axiom,(
    genls(c_electrolyte,c_inanimateobject) )).

fof(ax3_1397,axiom,(
    ! [OBJ] :
      ( electrolyte(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #493249:
fof(ax3_1398,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomresearchtrianglelab4191millermillershtml)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #799481:
fof(ax3_1399,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdelfininternationalcom3dvd6htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #535126:
fof(ax3_1400,axiom,(
    genlmt(f_contextofpcwfn(c_fairhousingact),c_basekb) )).

% Cyc Assertion #1756800:
fof(ax3_1401,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dailyhaggiscomindexphp200402page2)),c_translation_33),c_basekb) )).

% Cyc Assertion #940831:
fof(ax3_1402,axiom,(
    arg2isa(c_thicknessofobject,c_distance_absolute) )).

fof(ax3_1403,axiom,(
    ! [ARG1,ARG2] :
      ( thicknessofobject(ARG1,ARG2)
     => distance_absolute(ARG2) ) )).

% Cyc Assertion #2185790:
fof(ax3_1404,axiom,(
    genlmt(c_tptp_member3714_mt,c_basekb) )).

% Cyc Assertion #179656:
fof(ax3_1405,axiom,(
    genlmt(c_equalityreasoningmt,c_basekb) )).

% Cyc Assertion #377973:
fof(ax3_1406,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_attackamilitaryconvoy,c_actiononobject,s_33fe2362_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_1407,axiom,(
    genls(f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_attackamilitaryconvoy,c_actiononobject,s_33fe2362_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_1408,axiom,(
    ! [OBJ] :
      ( unsatisfactoryattempttofnpropersubcollectionnamedfn_ternaryattackamilitaryconvoyactiononobject33fe2362_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1221066:
fof(ax3_1409,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #325836:
fof(ax3_1410,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaskmencommenentertainment44c_brad_pitthtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1603909:
fof(ax3_1411,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),f_glassboxallotmentfn(s_5a92e6bd_f727_4f58_93bc_7073c663adbe),c_nooescape_theprogram),c_basekb) )).

% Cyc Assertion #2175110:
fof(ax3_1412,axiom,(
    genlmt(c_tptp_member1044_mt,c_basekb) )).

% Cyc Assertion #1002869:
fof(ax3_1413,axiom,(
    genlmt(f_contentmtfn(c_nationalatlas_fedlanp020_ks),c_basekb) )).

% Cyc Assertion #1389924:
fof(ax3_1414,axiom,(
    genls(c_agent_generic,c_partiallyintangibleindividual) )).

fof(ax3_1415,axiom,(
    ! [OBJ] :
      ( agent_generic(OBJ)
     => partiallyintangibleindividual(OBJ) ) )).

% Cyc Assertion #339580:
fof(ax3_1416,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_listsibiblioorgpipermailcorpus_paul20030323004209html)),c_translation_33),c_basekb) )).

% Cyc Assertion #2183470:
fof(ax3_1417,axiom,(
    genlmt(c_tptp_member3134_mt,c_basekb) )).

% Cyc Assertion #207805:
fof(ax3_1418,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_30),c_basekb) )).

% Cyc Assertion #914628:
fof(ax3_1419,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfreerepubliccomfocuskeywordkgenerationy)),c_translation_33),c_basekb) )).

% Cyc Assertion #1054441:
fof(ax3_1420,axiom,(
    genlmt(c_toehypotheticalstructure_coausagemt,c_basekb) )).

% Cyc Assertion #930574:
fof(ax3_1421,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsegulletorgindexphpshowtopic42218)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2174530:
fof(ax3_1422,axiom,(
    genlmt(c_tptp_member899_mt,c_basekb) )).

% Cyc Assertion #874685:
fof(ax3_1423,axiom,(
    genlmt(f_contextofpcwfn(c_thefirstcommandment),c_humansociallifemt) )).

% Cyc Assertion #1427745:
fof(ax3_1424,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),f_glassboxallotmentfn(s_9c416432_b89a_4a1c_8796_12ce4f0f1626),c_cycanalyticenvironment_theprogram),c_basekb) )).

% Cyc Assertion #1206650:
fof(ax3_1425,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreachouttrustorgarticlesrelatedsubjectslegalismhtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #2181102:
fof(ax3_1426,axiom,(
    genlmt(c_tptp_member2542_mt,c_basekb) )).

% Cyc Assertion #2180506:
fof(ax3_1427,axiom,(
    genlmt(c_tptp_member2393_mt,c_basekb) )).

% Cyc Assertion #264104:
fof(ax3_1428,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_besuccessfulinlife,c_individual,s_34024213_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_1429,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_besuccessfulinlife,c_individual,s_34024213_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_1430,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarybesuccessfulinlifeindividual34024213_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #438160:
fof(ax3_1431,axiom,(
    genls(c_temporalthingtypebyexistentialstatus,c_collection) )).

fof(ax3_1432,axiom,(
    ! [OBJ] :
      ( temporalthingtypebyexistentialstatus(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #196746:
fof(ax3_1433,axiom,(
    genls(c_sublatomwithvalue,c_individual) )).

fof(ax3_1434,axiom,(
    ! [OBJ] :
      ( sublatomwithvalue(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2514339:
fof(ax3_1435,axiom,
    ( mtvisible(c_tptpgeo_member7_mt)
   => borderson(c_georegion_l4_x50_y66,c_georegion_l4_x50_y67) )).

% Cyc Assertion #1756683:
fof(ax3_1436,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_historynasagovsp_09_511pdf)),c_translation_32),c_basekb) )).

% Cyc Assertion #1406064:
fof(ax3_1437,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive200409)),c_translation_0),c_basekb) )).

% Cyc Assertion #384618:
fof(ax3_1438,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhssenieedusgstaffkahackwomenhtm)),c_translation_11),c_basekb) )).

% Cyc Assertion #2180882:
fof(ax3_1439,axiom,(
    genlmt(c_tptp_member2487_mt,c_basekb) )).

% Cyc Assertion #2182686:
fof(ax3_1440,axiom,(
    genlmt(c_tptp_member2938_mt,c_basekb) )).

% Cyc Assertion #2174690:
fof(ax3_1441,axiom,(
    genlmt(c_tptp_member939_mt,c_basekb) )).

% Cyc Assertion #1183100:
fof(ax3_1442,axiom,(
    genlmt(c_unitednationsorganizationmt,c_peopledatamt) )).

% Cyc Assertion #385707:
fof(ax3_1443,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_fwsistercitiesorgpdfsmbabanembabane20activity20pages2pdf))) )).

% Cyc Assertion #1279005:
fof(ax3_1444,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_faithpropadeuticcomhistorydebateshtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #157801:
fof(ax3_1445,axiom,(
    genlmt(c_productphysicalcharacteristicsmt,c_basekb) )).

% Cyc Assertion #1474779:
fof(ax3_1446,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgotquestionsorgbook_of_1_corinthianshtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #204182:
fof(ax3_1447,axiom,(
    genlmt(c_computerrunningmt,c_basekb) )).

% Cyc Assertion #1543792:
fof(ax3_1448,axiom,(
    genlmt(c_alphacriterion4_infoconcriterionmt,c_basekb) )).

% Cyc Assertion #1479065:
fof(ax3_1449,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_settlersjeep,c_partiallytangible,s_3425a891_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_1450,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_settlersjeep,c_partiallytangible,s_3425a891_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_1451,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarysettlersjeeppartiallytangible3425a891_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1079872:
fof(ax3_1452,axiom,(
    genlmt(c_vistestmt,c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #953062:
fof(ax3_1453,axiom,(
    genlmt(c_humanailmentvocabularymt,c_basekb) )).

% Cyc Assertion #2186554:
fof(ax3_1454,axiom,(
    genlmt(c_tptp_member3905_mt,c_basekb) )).

% Cyc Assertion #207697:
fof(ax3_1455,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwangelfirecomtnbradrenfrotheclienthtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2483115:
fof(ax3_1456,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x63_y72) )).

% Cyc Assertion #472946:
fof(ax3_1457,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #994656:
fof(ax3_1458,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfreerepubliccomfocuskeywordkgenerationy)),c_translation_31),c_basekb) )).

% Cyc Assertion #884142:
fof(ax3_1459,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_12),c_machinelearningspindleheadmt) )).

% Cyc Assertion #613011:
fof(ax3_1460,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwspiritofhopemcckcorgfellowshipnominee20announced20for20next20mcc20moderatorhtm)),c_translation_1),c_basekb) )).

% Cyc Assertion #624789:
fof(ax3_1461,axiom,(
    genls(c_supportingrevolutionaries,c_individual) )).

fof(ax3_1462,axiom,(
    ! [OBJ] :
      ( supportingrevolutionaries(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1447430:
fof(ax3_1463,axiom,(
    genlmt(c_saicterroristgroupsdatamt,c_keinteractionresourcetestmt) )).

% Cyc Assertion #1020408:
fof(ax3_1464,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_kitchenutinsil,c_thing,s_340639b6_f4ed_11d9_9bea_0002b3a85b0b))
     => thing(OBJ) ) )).

fof(ax3_1465,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_kitchenutinsil,c_thing,s_340639b6_f4ed_11d9_9bea_0002b3a85b0b),c_thing) )).

fof(ax3_1466,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarykitchenutinsilthing340639b6_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1701933:
fof(ax3_1467,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive200409)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #197164:
fof(ax3_1468,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetclearweatherareamoderatewindarea(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1616921:
fof(ax3_1469,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_bank_underwater))
     => individual(OBJ) ) )).

fof(ax3_1470,axiom,(
    genls(f_groupfn(c_bank_underwater),c_individual) )).

fof(ax3_1471,axiom,(
    ! [OBJ] :
      ( groupfnbank_underwater(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2498141:
fof(ax3_1472,axiom,
    ( mtvisible(c_tptpgeo_member2_mt)
   => geographicalsubregions(c_georegion_l3_x25_y7,c_georegion_l4_x77_y22) )).

% Cyc Assertion #2186302:
fof(ax3_1473,axiom,(
    genlmt(c_tptp_member3842_mt,c_basekb) )).

% Cyc Assertion #614120:
fof(ax3_1474,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordstargateoffset0)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1460677:
fof(ax3_1475,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #1693207:
fof(ax3_1476,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoutherncteduorganizationshcr2002nonfictioncooperhtm)),c_translation_31),c_basekb) )).

% Cyc Assertion #1515045:
fof(ax3_1477,axiom,(
    genls(c_politicalevent_statelevel_negative,c_collection) )).

fof(ax3_1478,axiom,(
    ! [OBJ] :
      ( politicalevent_statelevel_negative(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1190181:
fof(ax3_1479,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoneplacecomministriesinsight_for_livingarticleasparticle_id228)),c_translation_33),c_basekb) )).

% Cyc Assertion #1682489:
fof(ax3_1480,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoftimagecomcommunityxsimagcsvolume_3issue_71htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2385583:
fof(ax3_1481,axiom,(
    individual(c_tptp12_dimethylhydrazine) )).

% Cyc Assertion #552365:
fof(ax3_1482,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfactmonstercomipkaa0761438html)),c_translation_2),c_basekb) )).

% Cyc Assertion #1030413:
fof(ax3_1483,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_outdoornetcomnewsrockies2002_11_22html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1303293:
fof(ax3_1484,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordadamsandleroffset0)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1168885:
fof(ax3_1485,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikihis_girl_friday)),c_translation_33),c_basekb) )).

% Cyc Assertion #2173698:
fof(ax3_1486,axiom,(
    genlmt(c_tptp_member691_mt,c_basekb) )).

% Cyc Assertion #356895:
fof(ax3_1487,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetheroicpersonmalehuman(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1242038:
fof(ax3_1488,axiom,(
    genlmt(c_uia_music_demoenvironmentmt,c_currentworlddatacollectormt_nonhomocentric) )).

% Cyc Assertion #1187317:
fof(ax3_1489,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofusedforeventtypefn(c_airplane,c_surveillance_informationgatheringactivity))
     => individual(OBJ) ) )).

fof(ax3_1490,axiom,(
    genls(f_subcollectionofusedforeventtypefn(c_airplane,c_surveillance_informationgatheringactivity),c_individual) )).

fof(ax3_1491,axiom,(
    ! [OBJ] :
      ( subcollectionofusedforeventtypefnairplanesurveillance_informationgatheringactivity(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2171782:
fof(ax3_1492,axiom,(
    genlmt(c_tptp_member212_mt,c_basekb) )).

% Cyc Assertion #1129480:
fof(ax3_1493,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_17),c_basekb) )).

% Cyc Assertion #1331959:
fof(ax3_1494,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_garnetacnsfsueduaooster)),c_translation_2),c_basekb) )).

% Cyc Assertion #2173022:
fof(ax3_1495,axiom,(
    genlmt(c_tptp_member522_mt,c_basekb) )).

% Cyc Assertion #1262089:
fof(ax3_1496,axiom,(
    genlmt(c_medicallexicalmt,c_basekb) )).

% Cyc Assertion #205337:
fof(ax3_1497,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_laughing_lawyertripodcompolitics2020law20fatherhoodgil_garcetti_ca_sewerhtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #271193:
fof(ax3_1498,axiom,(
    genlmt(c_outdatedforceratioprerequisitesmt,c_basekb) )).

% Cyc Assertion #1042005:
fof(ax3_1499,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikibruce_lee)),c_translation_33),c_basekb) )).

% Cyc Assertion #2181438:
fof(ax3_1500,axiom,(
    genlmt(c_tptp_member2626_mt,c_basekb) )).

% Cyc Assertion #2477271:
fof(ax3_1501,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x2_y6) )).

% Cyc Assertion #2198037:
fof(ax3_1502,axiom,(
    ! [TERM] :
      ( shavingrazor_manual(TERM)
     => tptp_8_271(f_relationexistsallfn(TERM,c_tptp_8_271,c_tptpcol_16_25972,c_shavingrazor_manual),TERM) ) )).

fof(ax3_1503,axiom,(
    relationexistsall(c_tptp_8_271,c_tptpcol_16_25972,c_shavingrazor_manual) )).

% Cyc Assertion #1471818:
fof(ax3_1504,axiom,(
    genls(c_molecularstuff,c_partiallytangible) )).

fof(ax3_1505,axiom,(
    ! [OBJ] :
      ( molecularstuff(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #896800:
fof(ax3_1506,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_wwwallwebdirectoriescomwwlanew_york_city_mesothelioma_asbestos_lawyerhtml))) )).

% Cyc Assertion #909866:
fof(ax3_1507,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinq7netent2003jun15ent_5_1htm)),c_translation_8),c_basekb) )).

% Cyc Assertion #1334644:
fof(ax3_1508,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_partiallytangible,c_derivedfrom,c_blood))
     => partiallytangible(OBJ) ) )).

fof(ax3_1509,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_partiallytangible,c_derivedfrom,c_blood),c_partiallytangible) )).

fof(ax3_1510,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnpartiallytangiblederivedfromblood(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2373125:
fof(ax3_1511,axiom,
    ( mtvisible(c_tptp_member3410_mt)
   => ridgeline_topographical(c_tptpridgeline_topographical_4) )).

% Cyc Assertion #141826:
fof(ax3_1512,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_romanticcardscomcgi_binamazonplasinsearchb00003cxae)),c_translation_33),c_basekb) )).

% Cyc Assertion #1174609:
fof(ax3_1513,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrockiesguidecomguiderocky_mountainsthe_terrain_parks_half_pipes_at_steamboat_springs_coloradohtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #190772:
fof(ax3_1514,axiom,(
    genlmt(c_worldgeographydualistmt,c_worldgeographymt) )).

% Cyc Assertion #692557:
fof(ax3_1515,axiom,(
    genls(c_sublcharacter,c_thing) )).

fof(ax3_1516,axiom,(
    ! [OBJ] :
      ( sublcharacter(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1672509:
fof(ax3_1517,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomhis20girl20friday)),c_translation_31),c_basekb) )).

% Cyc Assertion #1245594:
fof(ax3_1518,axiom,(
    genlmt(c_pq103_110mt,c_testvocabularymt) )).

% Cyc Assertion #186183:
fof(ax3_1519,axiom,(
    genlmt(f_modelmtbyuserandtaskfn(c_akbuser,c_allotment_9),c_basekb) )).

% Cyc Assertion #426922:
fof(ax3_1520,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_27),c_basekb) )).

% Cyc Assertion #2181328:
fof(ax3_1521,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member2598_mt) )).

% Cyc Assertion #1294588:
fof(ax3_1522,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_sensusmappingmt)
        & artsupplies(OBJ) )
     => isa(OBJ,f_meaninginsystemfn(c_sensus_information1997,s_separable_entity)) ) )).

fof(ax3_1523,axiom,
    ( mtvisible(c_sensusmappingmt)
   => genls(c_artsupplies,f_meaninginsystemfn(c_sensus_information1997,s_separable_entity)) )).

fof(ax3_1524,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_sensusmappingmt)
        & artsupplies(OBJ) )
     => meaninginsystemfnsensus_information1997separable_entity(OBJ) ) )).

% Cyc Assertion #380795:
fof(ax3_1525,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentfilm4009157stm)),c_translation_33),c_basekb) )).

% Cyc Assertion #1187137:
fof(ax3_1526,axiom,(
    genlmt(c_theoryofsciencemt,c_basekb) )).

% Cyc Assertion #1404812:
fof(ax3_1527,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_192192255165htmldocs05_roy20linpdf)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #893104:
fof(ax3_1528,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_accessoryfn_activity(c_scubadiving))
     => artifact(OBJ) ) )).

fof(ax3_1529,axiom,(
    genls(f_accessoryfn_activity(c_scubadiving),c_artifact) )).

fof(ax3_1530,axiom,(
    ! [OBJ] :
      ( accessoryfn_activityscubadiving(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1520358:
fof(ax3_1531,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomben20hecht)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1419005:
fof(ax3_1532,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_copperperchlorate,c_partiallytangible) )).

fof(ax3_1533,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & copperperchlorate(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #344141:
fof(ax3_1534,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordozoffset0)),c_translation_26),c_basekb) )).

% Cyc Assertion #1072905:
fof(ax3_1535,axiom,(
    genlmt(c_cns_ahmadal_fadtestimonymt,c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #883464:
fof(ax3_1536,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaint_it_coolcomdisplaycgiid8211next1)),c_translation_2),c_basekb) )).

% Cyc Assertion #626758:
fof(ax3_1537,axiom,(
    genlmt(c_humansociallifemt,c_humanactivitiesmt) )).

% Cyc Assertion #2181114:
fof(ax3_1538,axiom,(
    genlmt(c_tptp_member2545_mt,c_basekb) )).

% Cyc Assertion #1286743:
fof(ax3_1539,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetpartiallytangiblespatiallycontinuousthing(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2173728:
fof(ax3_1540,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member698_mt) )).

% Cyc Assertion #1877883:
fof(ax3_1541,axiom,(
    genls(c_tptpcol_13_22056,c_tptpcol_12_22055) )).

fof(ax3_1542,axiom,(
    ! [OBJ] :
      ( tptpcol_13_22056(OBJ)
     => tptpcol_12_22055(OBJ) ) )).

% Cyc Assertion #2215357:
fof(ax3_1543,axiom,(
    genlmt(c_theprototypicallexiconextensionhypothesismttypeforlanguagefncatalanlanguage,c_basekb) )).

% Cyc Assertion #892279:
fof(ax3_1544,axiom,(
    ~ spatiallydisjointobjecttype(c_vulnerabletoactivitymonitoring) )).

% Cyc Assertion #646463:
fof(ax3_1545,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecomforumtmaspm62284mpage5)),c_translation_1),c_basekb) )).

% Cyc Assertion #143425:
fof(ax3_1546,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_abbreviationsvirtualsplatcommeaningmoviesmovies_name_details_tasp)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2463163:
fof(ax3_1547,axiom,(
    genlmt(c_tptpgeo_spindlecollectormt,c_tptpgeo_member7_mt) )).

% Cyc Assertion #1577723:
fof(ax3_1548,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic2418494viewnew)),c_translation_3),c_basekb) )).

% Cyc Assertion #2183134:
fof(ax3_1549,axiom,(
    genlmt(c_tptp_member3050_mt,c_basekb) )).

% Cyc Assertion #1234592:
fof(ax3_1550,axiom,(
    genls(c_saltyodor,c_partiallytangible) )).

fof(ax3_1551,axiom,(
    ! [OBJ] :
      ( saltyodor(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #430501:
fof(ax3_1552,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc33477)),c_translation_6),c_basekb) )).

% Cyc Assertion #1624792:
fof(ax3_1553,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_librarydeltastateeduarchivesguidesoralhistorycivilrightspearson3html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2186698:
fof(ax3_1554,axiom,(
    genlmt(c_tptp_member3941_mt,c_basekb) )).

% Cyc Assertion #1093210:
fof(ax3_1555,axiom,(
    genlmt(c_myseparsingmt_johndoe,c_basekb) )).

% Cyc Assertion #727931:
fof(ax3_1556,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dpsinfocomdpsanameshtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #860403:
fof(ax3_1557,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_12),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1047050:
fof(ax3_1558,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwachievementorgautodocpagetan0int_4)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1923873:
fof(ax3_1559,axiom,(
    genls(c_tptpcol_8_40451,c_tptpcol_7_39939) )).

fof(ax3_1560,axiom,(
    ! [OBJ] :
      ( tptpcol_8_40451(OBJ)
     => tptpcol_7_39939(OBJ) ) )).

% Cyc Assertion #2477701:
fof(ax3_1561,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x18_y4) )).

% Cyc Assertion #1109388:
fof(ax3_1562,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_16),c_machinelearningspindleheadmt) )).

% Cyc Assertion #840978:
fof(ax3_1563,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombapoliceservicesofnorthernirelandstation,c_actiononobject,s_33f37505_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_1564,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombapoliceservicesofnorthernirelandstation,c_actiononobject,s_33f37505_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_1565,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarybombapoliceservicesofnorthernirelandstationactiononobject33f37505_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #350481:
fof(ax3_1566,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_currency))
     => partiallytangible(OBJ) ) )).

fof(ax3_1567,axiom,(
    genls(f_groupfn(c_currency),c_partiallytangible) )).

fof(ax3_1568,axiom,(
    ! [OBJ] :
      ( groupfncurrency(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #808875:
fof(ax3_1569,axiom,(
    genls(c_lit,c_partiallytangible) )).

fof(ax3_1570,axiom,(
    ! [OBJ] :
      ( lit(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #829998:
fof(ax3_1571,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinq7netent2003jun15ent_5_1htm)),c_translation_6),c_basekb) )).

% Cyc Assertion #1459060:
fof(ax3_1572,axiom,(
    genlmt(c_alpha_infoconlevelmt,c_basekb) )).

% Cyc Assertion #656483:
fof(ax3_1573,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_3),c_basekb) )).

% Cyc Assertion #1593020:
fof(ax3_1574,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_sitreport_seeking_information_war_on_terrorism),c_basekb) )).

% Cyc Assertion #1763443:
fof(ax3_1575,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreadiocomarchives030205bbroadway5html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #465197:
fof(ax3_1576,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomscrewball20comedy20film)),c_translation_29),c_basekb) )).

% Cyc Assertion #1150069:
fof(ax3_1577,axiom,(
    genls(c_defiladefightingposition,c_individual) )).

fof(ax3_1578,axiom,(
    ! [OBJ] :
      ( defiladefightingposition(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2172026:
fof(ax3_1579,axiom,(
    genlmt(c_tptp_member273_mt,c_basekb) )).

% Cyc Assertion #2095637:
fof(ax3_1580,axiom,(
    genls(c_tptpcol_13_109158,c_tptpcol_12_109157) )).

fof(ax3_1581,axiom,(
    ! [OBJ] :
      ( tptpcol_13_109158(OBJ)
     => tptpcol_12_109157(OBJ) ) )).

% Cyc Assertion #1406664:
fof(ax3_1582,axiom,(
    genls(c_advertisement_print,c_partiallytangible) )).

fof(ax3_1583,axiom,(
    ! [OBJ] :
      ( advertisement_print(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #364246:
fof(ax3_1584,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadiannorthern_foundationcanadaright)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1675266:
fof(ax3_1585,axiom,
    ( mtvisible(c_englishmt)
   => prettystring(f_subcollectionofwithrelationfromtypefn(c_terrorist,c_hasmembers,c_terroristgroup),s_terroriststhathasbeenamemberofaterroristgroup) )).

% Cyc Assertion #1086290:
fof(ax3_1586,axiom,(
    transitivebinarypredicate(c_visibleparts) )).

% Cyc Assertion #385707:
fof(ax3_1587,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_fwsistercitiesorgpdfsmbabanembabane20activity20pages2pdf))) )).

% Cyc Assertion #983481:
fof(ax3_1588,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #968846:
fof(ax3_1589,axiom,(
    genlmt(c_ilpmode_permissivegenorthstrategymt,c_machinelearningspindleheadmt) )).

% Cyc Assertion #2364777:
fof(ax3_1590,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3268_mt)
        & morrobaykangaroorat(INS) )
     => tptpofobject(INS,f_tptpquantityfn_13(n_644)) ) )).

fof(ax3_1591,axiom,
    ( mtvisible(c_tptp_member3268_mt)
   => relationallinstance(c_tptpofobject,c_morrobaykangaroorat,f_tptpquantityfn_13(n_644)) )).

% Cyc Assertion #1345203:
fof(ax3_1592,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbellaonlinecomarticlespart38244asp)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1122670:
fof(ax3_1593,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbilkentedutrjastnumber11oppermann_frhtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #281692:
fof(ax3_1594,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_33),c_basekb) )).

% Cyc Assertion #822530:
fof(ax3_1595,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmanythingsorgvoa02020225dr_thtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #503487:
fof(ax3_1596,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwejumpcutorgarchiveonlinessaysjc06folderearthqtowinfernohtml)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1341616:
fof(ax3_1597,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_17),c_machinelearningspindleheadmt) )).

% Cyc Assertion #683763:
fof(ax3_1598,axiom,(
    genls(c_disposingofanexplosivedeviceviaremotecontrolleddevice,c_individual) )).

fof(ax3_1599,axiom,(
    ! [OBJ] :
      ( disposingofanexplosivedeviceviaremotecontrolleddevice(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #897990:
fof(ax3_1600,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmtsuedusocworkfrostgodmohicanshtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #594652:
fof(ax3_1601,axiom,(
    genlmt(c_statedepartmentcountryreportsoneconomicpolicy1997mt,c_hpkbvocabmt) )).

% Cyc Assertion #1415098:
fof(ax3_1602,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_industryinfrastructurereqfn(f_productionindustrytypefn(c_militaryhardware)))
     => partiallytangible(OBJ) ) )).

fof(ax3_1603,axiom,(
    genls(f_industryinfrastructurereqfn(f_productionindustrytypefn(c_militaryhardware)),c_partiallytangible) )).

fof(ax3_1604,axiom,(
    ! [OBJ] :
      ( industryinfrastructurereqfnproductionindustrytypefnmilitaryhardware(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1496376:
fof(ax3_1605,axiom,(
    genlmt(c_recenteventsmt,c_basekb) )).

% Cyc Assertion #1153590:
fof(ax3_1606,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_2),c_basekb) )).

% Cyc Assertion #412517:
fof(ax3_1607,axiom,(
    genls(c_zsu_23_4,c_partiallytangible) )).

fof(ax3_1608,axiom,(
    ! [OBJ] :
      ( zsu_23_4(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1664150:
fof(ax3_1609,axiom,(
    uniformresourcelocator(f_urlfn(f_urlfn(s_http_wwwahwatukeecomafnentertainmentarticles030423ahtml))) )).

% Cyc Assertion #747997:
fof(ax3_1610,axiom,(
    genlmt(c_miptdatabase19681997_temporarymt,c_ldscgeneralcollectormt) )).

% Cyc Assertion #1764621:
fof(ax3_1611,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreenselectcoukvisitoreditorial562html)),c_translation_15),c_basekb) )).

% Cyc Assertion #643172:
fof(ax3_1612,axiom,(
    genlmt(c_individualhumanactivitiesmt,c_basekb) )).

% Cyc Assertion #1233767:
fof(ax3_1613,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archivestcmieirishexaminer20000826currentfpage_7htm)),c_translation_29),c_basekb) )).

% Cyc Assertion #1431826:
fof(ax3_1614,axiom,(
    genls(c_luggagemarketcategory,c_artifact) )).

fof(ax3_1615,axiom,(
    ! [OBJ] :
      ( luggagemarketcategory(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #170420:
fof(ax3_1616,axiom,(
    genlmt(c_eiapagesmt,c_basekb) )).

% Cyc Assertion #1030844:
fof(ax3_1617,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_memberstripodcommarzullotolivierhtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #988215:
fof(ax3_1618,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnycedocomedocorppageba1htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #304677:
fof(ax3_1619,axiom,(
    genlmt(c_temporarylexicalassertions_productlinkingmt,c_basekb) )).

% Cyc Assertion #488812:
fof(ax3_1620,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1141240:
fof(ax3_1621,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumfrankblacknettopicasptopic_id11553whichpage12)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2182850:
fof(ax3_1622,axiom,(
    genlmt(c_tptp_member2979_mt,c_basekb) )).

% Cyc Assertion #2176814:
fof(ax3_1623,axiom,(
    genlmt(c_tptp_member1470_mt,c_basekb) )).

% Cyc Assertion #1774135:
fof(ax3_1624,axiom,(
    genlmt(c_buildingcontentsvocabularymt,c_basekb) )).

% Cyc Assertion #2484090:
fof(ax3_1625,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x75_y75) )).

% Cyc Assertion #986502:
fof(ax3_1626,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_xrysostomblogspotcom2005_09_01_xrysostom_archivehtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #533521:
fof(ax3_1627,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_attackthesupremecourtbuildinginpristina,c_actiononobject,s_33f5e603_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_1628,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_attackthesupremecourtbuildinginpristina,c_actiononobject,s_33f5e603_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_1629,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternaryattackthesupremecourtbuildinginpristinaactiononobject33f5e603_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #182054:
fof(ax3_1630,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_landtransportationvehicle))
     => partiallytangible(OBJ) ) )).

fof(ax3_1631,axiom,(
    genls(f_groupfn(c_landtransportationvehicle),c_partiallytangible) )).

fof(ax3_1632,axiom,(
    ! [OBJ] :
      ( groupfnlandtransportationvehicle(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1539999:
fof(ax3_1633,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbluewaterwebcomnewsletterssept05_doyle2asp)),c_translation_30),c_basekb) )).

% Cyc Assertion #873624:
fof(ax3_1634,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcranstononlinecomlifebeatsearchnewsaspid6264)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1640389:
fof(ax3_1635,axiom,(
    genlmt(c_cookingworldtestcaseentitiesmt,c_basekb) )).

% Cyc Assertion #935805:
fof(ax3_1636,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwharrynilssoninfoindexphppagesearchsubactionsearchexpandnilssonpagesdetailpeter20lawford)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #495893:
fof(ax3_1637,axiom,(
    genlmt(c_courseofactionevaluationmt,c_basekb) )).

% Cyc Assertion #311258:
fof(ax3_1638,axiom,(
    physicalorderingpredicate(c_in_contcompletely) )).

% Cyc Assertion #1068933:
fof(ax3_1639,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wildcatarizonaedupapers911407_1_mhtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #226851:
fof(ax3_1640,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_1401301894vglance)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1289149:
fof(ax3_1641,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_scauwaterloocafashionarchiveshcos03hcos09cl)),c_translation_2),c_basekb) )).

% Cyc Assertion #425193:
fof(ax3_1642,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweonlinecomnewsitems011107000html)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1520641:
fof(ax3_1643,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #273148:
fof(ax3_1644,axiom,(
    genlmt(f_contextofpcwfn(c_witbrockphdthesis),c_ldscgeneralcollectormt) )).

% Cyc Assertion #259988:
fof(ax3_1645,axiom,(
    arg2isa(c_linkscut_subsystem,c_setorcollection) )).

fof(ax3_1646,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( linkscut_subsystem(ARG1,ARG2,ARG3)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #1677831:
fof(ax3_1647,axiom,(
    genls(c_warrantofficertypebyrank,c_collection) )).

fof(ax3_1648,axiom,(
    ! [OBJ] :
      ( warrantofficertypebyrank(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #179561:
fof(ax3_1649,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_factorybuildingcomplex,c_mainconstituent,c_petroleumproduct))
     => partiallytangible(OBJ) ) )).

fof(ax3_1650,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_factorybuildingcomplex,c_mainconstituent,c_petroleumproduct),c_partiallytangible) )).

fof(ax3_1651,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnfactorybuildingcomplexmainconstituentpetroleumproduct(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1095288:
fof(ax3_1652,axiom,(
    genlmt(c_tclscriptingdomainmt,c_basekb) )).

% Cyc Assertion #1172522:
fof(ax3_1653,axiom,(
    genls(c_uh_60lblackhawk,c_partiallytangible) )).

fof(ax3_1654,axiom,(
    ! [OBJ] :
      ( uh_60lblackhawk(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2176622:
fof(ax3_1655,axiom,(
    genlmt(c_tptp_member1422_mt,c_basekb) )).

% Cyc Assertion #2245310:
fof(ax3_1656,axiom,(
    genlmt(c_theprototypicalsksischematranslationmicrotheory,c_basekb) )).

% Cyc Assertion #2178856:
fof(ax3_1657,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member1980_mt) )).

% Cyc Assertion #2180066:
fof(ax3_1658,axiom,(
    genlmt(c_tptp_member2283_mt,c_basekb) )).

% Cyc Assertion #2182634:
fof(ax3_1659,axiom,(
    genlmt(c_tptp_member2925_mt,c_basekb) )).

% Cyc Assertion #1211021:
fof(ax3_1660,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_the_cruciblebiographyms)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1745170:
fof(ax3_1661,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_crossing,c_partiallytangible,s_341a5df2_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_1662,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_crossing,c_partiallytangible,s_341a5df2_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_1663,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarycrossingpartiallytangible341a5df2_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #921615:
fof(ax3_1664,axiom,(
    genls(c_supportvehicle,c_individual) )).

fof(ax3_1665,axiom,(
    ! [OBJ] :
      ( supportvehicle(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #791527:
fof(ax3_1666,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_digitaldreamdoorcompagesmovie_maleperf90html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2361972:
fof(ax3_1667,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3751_mt)
        & shipping_receivingclerk(INS) )
     => tptpofobject(INS,f_tptpquantityfn_1(n_891)) ) )).

fof(ax3_1668,axiom,
    ( mtvisible(c_tptp_member3751_mt)
   => relationallinstance(c_tptpofobject,c_shipping_receivingclerk,f_tptpquantityfn_1(n_891)) )).

% Cyc Assertion #2150068:
fof(ax3_1669,axiom,(
    genls(c_tptpcol_16_130932,c_tptpcol_15_130931) )).

fof(ax3_1670,axiom,(
    ! [OBJ] :
      ( tptpcol_16_130932(OBJ)
     => tptpcol_15_130931(OBJ) ) )).

% Cyc Assertion #2185894:
fof(ax3_1671,axiom,(
    genlmt(c_tptp_member3740_mt,c_basekb) )).

% Cyc Assertion #965588:
fof(ax3_1672,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_netessaysnetviewpaper8968html)),c_translation_33),c_basekb) )).

% Cyc Assertion #2180638:
fof(ax3_1673,axiom,(
    genlmt(c_tptp_member2426_mt,c_basekb) )).

% Cyc Assertion #1209266:
fof(ax3_1674,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwidthaiorgpublicationpdfvol19_1pdf)),c_translation_33),c_basekb) )).

% Cyc Assertion #1534122:
fof(ax3_1675,axiom,(
    genlmt(c_calendarsvocabularymt,c_generictemporalvocabularymt) )).

% Cyc Assertion #786733:
fof(ax3_1676,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweonlinecomcelebsqahoffmanintrview2html)),c_translation_32),c_basekb) )).

% Cyc Assertion #676866:
fof(ax3_1677,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleadingauthoritiescomtalentaallen_debbieallen_debbiedoc)),c_translation_32),c_basekb) )).

% Cyc Assertion #2171150:
fof(ax3_1678,axiom,(
    genlmt(c_tptp_member54_mt,c_basekb) )).

% Cyc Assertion #948870:
fof(ax3_1679,axiom,(
    genls(c_videoclip,c_individual) )).

fof(ax3_1680,axiom,(
    ! [OBJ] :
      ( videoclip(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #251932:
fof(ax3_1681,axiom,(
    genls(c_golemterm,c_thing) )).

fof(ax3_1682,axiom,(
    ! [OBJ] :
      ( golemterm(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #385210:
fof(ax3_1683,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetmilitaryequipmentgroupfncommunicationdevice(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #416709:
fof(ax3_1684,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_femalegendername,c_individual,s_34021b05_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_1685,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_femalegendername,c_individual,s_34021b05_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_1686,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryfemalegendernameindividual34021b05_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #922350:
fof(ax3_1687,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1469797:
fof(ax3_1688,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnytimescombooksfirstssteyn_broadwayhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #290312:
fof(ax3_1689,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomassets12010html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #266222:
fof(ax3_1690,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_priceseekeryo_storecompssling_bladepage_2)),c_translation_32),c_basekb) )).

% Cyc Assertion #1392610:
fof(ax3_1691,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumfrankblacknettopicasptopic_id11553whichpage12)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #897391:
fof(ax3_1692,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbfiorguksightandsoundreviewsdetailsphpid197)),c_translation_29),c_basekb) )).

% Cyc Assertion #615650:
fof(ax3_1693,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_timblairspleenvillecomarchives007948php)),c_translation_12),c_basekb) )).

% Cyc Assertion #503882:
fof(ax3_1694,axiom,(
    arg1isa(c_smugglingfn,c_collection) )).

% Cyc Assertion #1728175:
fof(ax3_1695,axiom,(
    genls(c_computertypebybrand,c_collection) )).

fof(ax3_1696,axiom,(
    ! [OBJ] :
      ( computertypebybrand(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #2179346:
fof(ax3_1697,axiom,(
    genlmt(c_tptp_member2103_mt,c_basekb) )).

% Cyc Assertion #1461037:
fof(ax3_1698,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineseatscomwill_smith_ticketsindexasp)),c_translation_25),c_basekb) )).

% Cyc Assertion #1452677:
fof(ax3_1699,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cgiebaycomwarning_world_demanding_god_inspired_story_manuscript_w0qqitemz7377202690qqcategoryz2196qqcmdzviewitem)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1146392:
fof(ax3_1700,axiom,(
    genls(c_tkbfullyspecifiedsourcemicrotheory,c_microtheory) )).

fof(ax3_1701,axiom,(
    ! [OBJ] :
      ( tkbfullyspecifiedsourcemicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #456015:
fof(ax3_1702,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfast_rewindcomgoingundercoverhtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1468972:
fof(ax3_1703,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic2418494viewnew)),c_translation_0),c_basekb) )).

% Cyc Assertion #412441:
fof(ax3_1704,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcelebritybookscommerchant2merchantmvcscreenprodproduct_code55005category_codecelebrity_bio)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #146733:
fof(ax3_1705,axiom,(
    genlmt(c_wamt_modevalinitial_p2,c_basekb) )).

% Cyc Assertion #1582205:
fof(ax3_1706,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #425625:
fof(ax3_1707,axiom,(
    genlmt(c_organizationgmt,c_basekb) )).

% Cyc Assertion #1422778:
fof(ax3_1708,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordchristinetayloroffset0)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1156655:
fof(ax3_1709,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetgravellysoilregionrockysoilregion(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1424794:
fof(ax3_1710,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_iran_and_the_bomb_a_nuclear_iran_poses_extreme_threat_to_us),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #282424:
fof(ax3_1711,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstathanasiusorgbiblejul_2_2000html)),c_translation_33),c_basekb) )).

% Cyc Assertion #2174646:
fof(ax3_1712,axiom,(
    genlmt(c_tptp_member928_mt,c_basekb) )).

% Cyc Assertion #595427:
fof(ax3_1713,axiom,(
    genls(c_firstordercollection,c_fixedordercollection) )).

fof(ax3_1714,axiom,(
    ! [OBJ] :
      ( firstordercollection(OBJ)
     => fixedordercollection(OBJ) ) )).

% Cyc Assertion #1582363:
fof(ax3_1715,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpvponlinecomnewsproarchivesarc7_2003html)),c_translation_33),c_basekb) )).

% Cyc Assertion #343751:
fof(ax3_1716,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #1121834:
fof(ax3_1717,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwphoenixnewtimescomissues2005_12_22cultureart2html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #925900:
fof(ax3_1718,axiom,(
    genls(c_pfizerimmunosurpresivesmarket,c_individual) )).

fof(ax3_1719,axiom,(
    ! [OBJ] :
      ( pfizerimmunosurpresivesmarket(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #633974:
fof(ax3_1720,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_28),c_basekb) )).

% Cyc Assertion #1767982:
fof(ax3_1721,axiom,(
    genls(c_shipoftheline,c_individual) )).

fof(ax3_1722,axiom,(
    ! [OBJ] :
      ( shipoftheline(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #674094:
fof(ax3_1723,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwroadsidegeorgiacomtoursgone_with_the_windhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #2178774:
fof(ax3_1724,axiom,(
    genlmt(c_tptp_member1960_mt,c_basekb) )).

% Cyc Assertion #293556:
fof(ax3_1725,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetdiplomaticmission_thepostdiplomatdiplomatembassybuilding(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #295009:
fof(ax3_1726,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_flyhiwaaynetwgannwalk_nt2corinthhtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #2175882:
fof(ax3_1727,axiom,(
    genlmt(c_tptp_member1237_mt,c_basekb) )).

% Cyc Assertion #2172266:
fof(ax3_1728,axiom,(
    genlmt(c_tptp_member333_mt,c_basekb) )).

% Cyc Assertion #938517:
fof(ax3_1729,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtodayinliteraturecombiographyarthurmillerasp)),c_translation_28),c_basekb) )).

% Cyc Assertion #2183934:
fof(ax3_1730,axiom,(
    genlmt(c_tptp_member3250_mt,c_basekb) )).

% Cyc Assertion #1589666:
fof(ax3_1731,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic2418494viewnew)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182190:
fof(ax3_1732,axiom,(
    genlmt(c_tptp_member2814_mt,c_basekb) )).

% Cyc Assertion #1497082:
fof(ax3_1733,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnowtorontocomissues2004_10_07music_discs2php)),c_translation_33),c_basekb) )).

% Cyc Assertion #1083554:
fof(ax3_1734,axiom,
    ( mtvisible(c_bpvi_backgroundvocabularymt)
   => genls(c_missinginaction,c_militaryperson) )).

fof(ax3_1735,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_bpvi_backgroundvocabularymt)
        & missinginaction(OBJ) )
     => militaryperson(OBJ) ) )).

% Cyc Assertion #396993:
fof(ax3_1736,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_m0fdnis_4_9ai_n9480678pg_17)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1132839:
fof(ax3_1737,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_https_wwwheritagepreservationorghhicase276html)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #227203:
fof(ax3_1738,axiom,(
    genlmt(c_linnaeantaxonomyphysiologymt,c_basekb) )).

% Cyc Assertion #264412:
fof(ax3_1739,axiom,(
    mereotopologyconcept(c_inregion) )).

% Cyc Assertion #1261479:
fof(ax3_1740,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_6),c_basekb) )).

% Cyc Assertion #2016466:
fof(ax3_1741,axiom,(
    firstordercollection(c_tptpcol_16_77491) )).

% Cyc Assertion #2181150:
fof(ax3_1742,axiom,(
    genlmt(c_tptp_member2554_mt,c_basekb) )).

% Cyc Assertion #1761230:
fof(ax3_1743,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhersheylibraryorgprogramsenrichmentclasseshtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #2176126:
fof(ax3_1744,axiom,(
    genlmt(c_tptp_member1298_mt,c_basekb) )).

% Cyc Assertion #2171608:
fof(ax3_1745,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member168_mt) )).

% Cyc Assertion #2175406:
fof(ax3_1746,axiom,(
    genlmt(c_tptp_member1118_mt,c_basekb) )).

% Cyc Assertion #1890047:
fof(ax3_1747,axiom,(
    genls(c_tptpcol_15_26922,c_tptpcol_14_26921) )).

fof(ax3_1748,axiom,(
    ! [OBJ] :
      ( tptpcol_15_26922(OBJ)
     => tptpcol_14_26921(OBJ) ) )).

% Cyc Assertion #643905:
fof(ax3_1749,axiom,(
    genlmt(c_pq117mt,c_basekb) )).

% Cyc Assertion #1005265:
fof(ax3_1750,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_biblescripturenethebrewshtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #925969:
fof(ax3_1751,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_moneycnncommagazinesfortunefortune_archive200512128363101)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1706595:
fof(ax3_1752,axiom,(
    genlmt(c_physicalagentvocabularymt,c_basekb) )).

% Cyc Assertion #1016421:
fof(ax3_1753,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomhowardhawks)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #721819:
fof(ax3_1754,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_14),c_basekb) )).

% Cyc Assertion #995549:
fof(ax3_1755,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiplacesftppyplacescanadacanadaright)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #1785128:
fof(ax3_1756,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_bllearningcouklive_extracts104860)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #989450:
fof(ax3_1757,axiom,(
    genls(c_thallium_201,c_partiallytangible) )).

fof(ax3_1758,axiom,(
    ! [OBJ] :
      ( thallium_201(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1499522:
fof(ax3_1759,axiom,(
    genls(c_contactlocation,c_partiallytangible) )).

fof(ax3_1760,axiom,(
    ! [OBJ] :
      ( contactlocation(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #470830:
fof(ax3_1761,axiom,(
    genlmt(c_wamt_evalinitial_p11,c_basekb) )).

% Cyc Assertion #1389559:
fof(ax3_1762,axiom,(
    ! [OBJ] :
      ( problemsolvingcntxt(OBJ)
     => microtheory(OBJ) ) )).

fof(ax3_1763,axiom,(
    genls(c_problemsolvingcntxt,c_microtheory) )).

% Cyc Assertion #714392:
fof(ax3_1764,axiom,
    ( mtvisible(c_uia_geography_demoenvironmentmt)
   => firstordercollection(f_prospectivecollectionfn(c_humanteenager,c_serialkiller)) )).

% Cyc Assertion #2176810:
fof(ax3_1765,axiom,(
    genlmt(c_tptp_member1469_mt,c_basekb) )).

% Cyc Assertion #1357913:
fof(ax3_1766,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2387968:
fof(ax3_1767,axiom,(
    individual(c_tptpsalvageship_1) )).

% Cyc Assertion #438635:
fof(ax3_1768,axiom,(
    genlmt(c_glf_concealmentone_renderingmt,c_basekb) )).

% Cyc Assertion #753997:
fof(ax3_1769,axiom,(
    genls(c_recoillesslauncher_hot,c_individual) )).

fof(ax3_1770,axiom,(
    ! [OBJ] :
      ( recoillesslauncher_hot(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #410263:
fof(ax3_1771,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlibvirginiaedusmallexhibitsrave_reviewsbeyond_gwtwhtml)),c_translation_30),c_basekb) )).

% Cyc Assertion #1178877:
fof(ax3_1772,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetinformationbearingthingagent_generic(OBJ)
     => partiallyintangibleindividual(OBJ) ) )).

% Cyc Assertion #1592135:
fof(ax3_1773,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_15),c_basekb) )).

% Cyc Assertion #513212:
fof(ax3_1774,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjfk_onlinecomjfk100bigjimhtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #1122466:
fof(ax3_1775,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_wwwpraguepostcomp032005art0825news5php))) )).

% Cyc Assertion #1179291:
fof(ax3_1776,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_dossier_abdul_halim_khaddam),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #888135:
fof(ax3_1777,axiom,(
    genlmt(c_commonlyacceptedexposurelimitsmt,c_unitedstatessociallifemt) )).

% Cyc Assertion #2185938:
fof(ax3_1778,axiom,(
    genlmt(c_tptp_member3751_mt,c_basekb) )).

% Cyc Assertion #1675775:
fof(ax3_1779,axiom,(
    genlmt(c_mysegenerationmt_peterwagner,c_basekb) )).

% Cyc Assertion #2365243:
fof(ax3_1780,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3115_mt)
        & ridgeline_topographical(INS) )
     => tptpofobject(INS,f_tptpquantityfn_16(n_215)) ) )).

fof(ax3_1781,axiom,
    ( mtvisible(c_tptp_member3115_mt)
   => relationallinstance(c_tptpofobject,c_ridgeline_topographical,f_tptpquantityfn_16(n_215)) )).

% Cyc Assertion #913288:
fof(ax3_1782,axiom,(
    rulemacropredicate(c_genls) )).

% Cyc Assertion #593068:
fof(ax3_1783,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvolumenycorgarticle_detailindexaspid151sectionwork)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #449018:
fof(ax3_1784,axiom,(
    reflexivebinarypredicate(c_prefixsubstring) )).

% Cyc Assertion #1286031:
fof(ax3_1785,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnyfolkloreorgprogsfc99explorehtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #2173354:
fof(ax3_1786,axiom,(
    genlmt(c_tptp_member605_mt,c_basekb) )).

% Cyc Assertion #286587:
fof(ax3_1787,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_stufffn(c_pickle))
     => partiallytangible(OBJ) ) )).

fof(ax3_1788,axiom,(
    genls(f_stufffn(c_pickle),c_partiallytangible) )).

fof(ax3_1789,axiom,(
    ! [OBJ] :
      ( stufffnpickle(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2180650:
fof(ax3_1790,axiom,(
    genlmt(c_tptp_member2429_mt,c_basekb) )).

% Cyc Assertion #1715615:
fof(ax3_1791,axiom,(
    genlmt(c_opencycexampletransportationplanningdomainmt,c_basekb) )).

% Cyc Assertion #2180386:
fof(ax3_1792,axiom,(
    genlmt(c_tptp_member2363_mt,c_basekb) )).

% Cyc Assertion #1768111:
fof(ax3_1793,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcinemacomnewsitem6680britons_considered_to_play_caped_crusaderphtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #378394:
fof(ax3_1794,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbiblebyteorgbytephpbyte283)),c_translation_33),c_basekb) )).

% Cyc Assertion #933478:
fof(ax3_1795,axiom,(
    genlmt(c_cyclifiercontentmodelmt_peterwagnerownsadog,c_basekb) )).

% Cyc Assertion #2176418:
fof(ax3_1796,axiom,(
    genlmt(c_tptp_member1371_mt,c_basekb) )).

% Cyc Assertion #340889:
fof(ax3_1797,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_humanteenager,c_isa,c_male))
     => thing(OBJ) ) )).

fof(ax3_1798,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_humanteenager,c_isa,c_male),c_thing) )).

fof(ax3_1799,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnhumanteenagerisamale(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #174094:
fof(ax3_1800,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_newyork_state))
     => individual(OBJ) ) )).

fof(ax3_1801,axiom,(
    genls(f_residentfn(c_newyork_state),c_individual) )).

fof(ax3_1802,axiom,(
    ! [OBJ] :
      ( residentfnnewyork_state(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2175366:
fof(ax3_1803,axiom,(
    genlmt(c_tptp_member1108_mt,c_basekb) )).

% Cyc Assertion #2172214:
fof(ax3_1804,axiom,(
    genlmt(c_tptp_member320_mt,c_basekb) )).

% Cyc Assertion #1346811:
fof(ax3_1805,axiom,(
    genlmt(c_wademiningmt,c_basekb) )).

% Cyc Assertion #465528:
fof(ax3_1806,axiom,(
    genls(c_fruitgiftbasket,c_artifact) )).

fof(ax3_1807,axiom,(
    ! [OBJ] :
      ( fruitgiftbasket(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #2384845:
fof(ax3_1808,axiom,(
    individual(c_tptpbakersfieldcactus_3) )).

% Cyc Assertion #2177006:
fof(ax3_1809,axiom,(
    genlmt(c_tptp_member1518_mt,c_basekb) )).

% Cyc Assertion #410786:
fof(ax3_1810,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_priceseekeryo_storecompssling_blade)),c_translation_33),c_basekb) )).

% Cyc Assertion #735565:
fof(ax3_1811,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmafhoumcompress274p51htm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1549750:
fof(ax3_1812,axiom,(
    genlmt(c_mipt_terroristeventsmt,c_keinteractionresourcetestmt) )).

% Cyc Assertion #1232478:
fof(ax3_1813,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #978786:
fof(ax3_1814,axiom,(
    genlmt(c_cycorpproductsmt,c_cycarchitecture_intermediatemt) )).

% Cyc Assertion #853811:
fof(ax3_1815,axiom,(
    genlmt(c_botanymt,c_basekb) )).

% Cyc Assertion #1274139:
fof(ax3_1816,axiom,(
    genls(c_rejectingauiainteraction,c_individual) )).

fof(ax3_1817,axiom,(
    ! [OBJ] :
      ( rejectingauiainteraction(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1541761:
fof(ax3_1818,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineseatscomwill_smith_ticketsindexasp)),c_translation_23),c_basekb) )).

% Cyc Assertion #1712330:
fof(ax3_1819,axiom,(
    microtheory(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaboundingloveorgsensationaloiigfoiigf_005php)),c_translation_33)) )).

% Cyc Assertion #1498729:
fof(ax3_1820,axiom,(
    genlmt(c_fm101_5_fieldmanual_appendixh,c_basekb) )).

% Cyc Assertion #2178686:
fof(ax3_1821,axiom,(
    genlmt(c_tptp_member1938_mt,c_basekb) )).

% Cyc Assertion #325784:
fof(ax3_1822,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnndbcompeople243000025168)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184374:
fof(ax3_1823,axiom,(
    genlmt(c_tptp_member3360_mt,c_basekb) )).

% Cyc Assertion #1014408:
fof(ax3_1824,axiom,(
    genls(c_cycinternaltask_researchcyc_project_the_66,c_individual) )).

fof(ax3_1825,axiom,(
    ! [OBJ] :
      ( cycinternaltask_researchcyc_project_the_66(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1697020:
fof(ax3_1826,axiom,(
    genlmt(f_contextofpcwfn(c_epistles),c_basekb) )).

% Cyc Assertion #877654:
fof(ax3_1827,axiom,(
    genls(c_cycinternaltask_butler,c_individual) )).

fof(ax3_1828,axiom,(
    ! [OBJ] :
      ( cycinternaltask_butler(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #660784:
fof(ax3_1829,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediafabliscomindexphptechnical_university_of_munich)),c_translation_8),c_basekb) )).

% Cyc Assertion #1618602:
fof(ax3_1830,axiom,(
    transitivebinarypredicate(c_specs) )).

% Cyc Assertion #1477695:
fof(ax3_1831,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #529374:
fof(ax3_1832,axiom,(
    genlmt(c_templateholdingmt,c_basekb) )).

% Cyc Assertion #712409:
fof(ax3_1833,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbraintrustdvcomessaysdigital_ragehtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #779350:
fof(ax3_1834,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cheerleaderyozcomarchives001947html)),c_translation_0),c_basekb) )).

% Cyc Assertion #1372017:
fof(ax3_1835,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprojocomcgi_binincludeplmoviesfilmscruciblehtm)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #825085:
fof(ax3_1836,axiom,(
    genlmt(c_wordnetmappingmt,c_cycorpproductsmt) )).

% Cyc Assertion #378626:
fof(ax3_1837,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_21),c_basekb) )).

% Cyc Assertion #1751877:
fof(ax3_1838,axiom,(
    genlmt(c_wordnetworkflowdatastatusmt,c_basekb) )).

% Cyc Assertion #478859:
fof(ax3_1839,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_profile_rifaat_al_assad),c_basekb) )).

% Cyc Assertion #2004724:
fof(ax3_1840,axiom,(
    genls(c_tptpcol_15_72793,c_tptpcol_14_72792) )).

fof(ax3_1841,axiom,(
    ! [OBJ] :
      ( tptpcol_15_72793(OBJ)
     => tptpcol_14_72792(OBJ) ) )).

% Cyc Assertion #2180994:
fof(ax3_1842,axiom,(
    genlmt(c_tptp_member2515_mt,c_basekb) )).

% Cyc Assertion #1216139:
fof(ax3_1843,axiom,(
    genlmt(c_case_3235139646,c_basekb) )).

% Cyc Assertion #479724:
fof(ax3_1844,axiom,(
    genlmt(c_agent_specificfactsheet_iranmt,c_hpkbvocabmt) )).

% Cyc Assertion #1779275:
fof(ax3_1845,axiom,(
    genls(c_buildingmaterial,c_artifact) )).

fof(ax3_1846,axiom,(
    ! [OBJ] :
      ( buildingmaterial(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1272577:
fof(ax3_1847,axiom,(
    genlmt(f_contextofpcwfn(c_dontburncandles),c_basekb) )).

% Cyc Assertion #279635:
fof(ax3_1848,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_22),c_machinelearningspindleheadmt) )).

% Cyc Assertion #171648:
fof(ax3_1849,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpowellscomcgi_binbiblioinkey2_193105620x_1)),c_translation_2),c_basekb) )).

% Cyc Assertion #272745:
fof(ax3_1850,axiom,(
    genlmt(c_rkfobservationap_glfmt,c_basekb) )).

% Cyc Assertion #360627:
fof(ax3_1851,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhssenieedusgstaffkahackwomenhtm)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1384761:
fof(ax3_1852,axiom,(
    microtheory(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_192192255165htmldocs05_roy20linpdf)),c_translation_0_885)) )).

% Cyc Assertion #879187:
fof(ax3_1853,axiom,(
    ! [OBJ] :
      ( collectionsubsetfnpartiallytangiblethesetofobj2thereexistsobj1thereexistsagentobscuresfromobj1obj2agent(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2181906:
fof(ax3_1854,axiom,(
    genlmt(c_tptp_member2743_mt,c_basekb) )).

% Cyc Assertion #1433098:
fof(ax3_1855,axiom,(
    genls(c_geodesyconcept,c_thing) )).

fof(ax3_1856,axiom,(
    ! [OBJ] :
      ( geodesyconcept(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2171739:
fof(ax3_1857,axiom,(
    genlmt(c_tptp_member201_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1355380:
fof(ax3_1858,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_7),c_basekb) )).

% Cyc Assertion #232591:
fof(ax3_1859,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtelereadorgblog2004_10_24_archivehtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1112838:
fof(ax3_1860,axiom,(
    genls(c_reformulationdirectionspecification,c_thing) )).

fof(ax3_1861,axiom,(
    ! [OBJ] :
      ( reformulationdirectionspecification(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1620009:
fof(ax3_1862,axiom,(
    genls(c_xml_element,c_inanimateobject) )).

fof(ax3_1863,axiom,(
    ! [OBJ] :
      ( xml_element(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #2463165:
fof(ax3_1864,axiom,(
    genlmt(c_tptpgeo_member8_mt,c_basekb) )).

% Cyc Assertion #2178050:
fof(ax3_1865,axiom,(
    genlmt(c_tptp_member1779_mt,c_basekb) )).

% Cyc Assertion #1137519:
fof(ax3_1866,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaonetfmoellerhebrewhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #182163:
fof(ax3_1867,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173590:
fof(ax3_1868,axiom,(
    genlmt(c_tptp_member664_mt,c_basekb) )).

% Cyc Assertion #496067:
fof(ax3_1869,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjoint_reviewsgovukassetsdocumentsenglishcardiffreportpdf)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1478358:
fof(ax3_1870,axiom,(
    genls(c_nationalwildandscenicriver_usfws,c_partiallytangible) )).

fof(ax3_1871,axiom,(
    ! [OBJ] :
      ( nationalwildandscenicriver_usfws(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2178270:
fof(ax3_1872,axiom,(
    genlmt(c_tptp_member1834_mt,c_basekb) )).

% Cyc Assertion #2057194:
fof(ax3_1873,axiom,(
    genls(c_tptpcol_13_93781,c_tptpcol_12_93765) )).

fof(ax3_1874,axiom,(
    ! [OBJ] :
      ( tptpcol_13_93781(OBJ)
     => tptpcol_12_93765(OBJ) ) )).

% Cyc Assertion #241000:
fof(ax3_1875,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmilupusorgpdffacts20you20should20know20handoutpdf)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184218:
fof(ax3_1876,axiom,(
    genlmt(c_tptp_member3321_mt,c_basekb) )).

% Cyc Assertion #473852:
fof(ax3_1877,axiom,(
    genlmt(c_fishermodelmt,c_basekb) )).

% Cyc Assertion #1729139:
fof(ax3_1878,axiom,(
    genls(c_ignorance,c_aspatialinformationstore) )).

fof(ax3_1879,axiom,(
    ! [OBJ] :
      ( ignorance(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #710465:
fof(ax3_1880,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #305585:
fof(ax3_1881,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcolumbusalivecom200020000406music1html)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #649769:
fof(ax3_1882,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_16),c_basekb) )).

% Cyc Assertion #590809:
fof(ax3_1883,axiom,(
    genlmt(c_ldscindexedinformationsourcemt,c_basekb) )).

% Cyc Assertion #2186154:
fof(ax3_1884,axiom,(
    genlmt(c_tptp_member3805_mt,c_basekb) )).

% Cyc Assertion #622303:
fof(ax3_1885,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhighbeamcomrefdoc0aspdocid1e1_indianap)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #376533:
fof(ax3_1886,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_trainingforfn(f_usinginstancefn(c_jonsmotorcycle)))
     => individual(OBJ) ) )).

fof(ax3_1887,axiom,(
    genls(f_trainingforfn(f_usinginstancefn(c_jonsmotorcycle)),c_individual) )).

fof(ax3_1888,axiom,(
    ! [OBJ] :
      ( trainingforfnusinginstancefnjonsmotorcycle(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1550122:
fof(ax3_1889,axiom,(
    spatiallydisjointobjecttype(c_electricalsupplymarketcategory) )).

% Cyc Assertion #1113494:
fof(ax3_1890,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizjournalscomtriadstories20040105daily32htmljsts_rs_hl)),c_translation_2),c_basekb) )).

% Cyc Assertion #2463146:
fof(ax3_1891,axiom,(
    genlmt(c_tptpgeo_member3_mt,c_tptpgeo_spindleheadmt) )).

% Cyc Assertion #986187:
fof(ax3_1892,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_30),c_basekb) )).

% Cyc Assertion #342718:
fof(ax3_1893,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_continentofnorthamerica))
     => individual(OBJ) ) )).

fof(ax3_1894,axiom,(
    genls(f_residentfn(c_continentofnorthamerica),c_individual) )).

fof(ax3_1895,axiom,(
    ! [OBJ] :
      ( residentfncontinentofnorthamerica(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #802856:
fof(ax3_1896,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(f_subcollectionofwithrelationtofn(c_adultfemalehuman,c_maritalstatus,c_married)))
     => partiallytangible(OBJ) ) )).

fof(ax3_1897,axiom,(
    genls(f_groupfn(f_subcollectionofwithrelationtofn(c_adultfemalehuman,c_maritalstatus,c_married)),c_partiallytangible) )).

fof(ax3_1898,axiom,(
    ! [OBJ] :
      ( groupfnsubcollectionofwithrelationtofnadultfemalehumanmaritalstatusmarried(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2179498:
fof(ax3_1899,axiom,(
    genlmt(c_tptp_member2141_mt,c_basekb) )).

% Cyc Assertion #2171118:
fof(ax3_1900,axiom,(
    genlmt(c_tptp_member46_mt,c_basekb) )).

% Cyc Assertion #231409:
fof(ax3_1901,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwabideinchristcommessages2timintrhtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1341522:
fof(ax3_1902,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineseatscomwill_smith_ticketsindexasp)),c_translation_28),c_basekb) )).

% Cyc Assertion #304907:
fof(ax3_1903,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcanoecajammoviesreviewsggrosse_pointehtml)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1573078:
fof(ax3_1904,axiom,(
    genls(c_animaltypebybodyposition,c_collection) )).

fof(ax3_1905,axiom,(
    ! [OBJ] :
      ( animaltypebybodyposition(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #623383:
fof(ax3_1906,axiom,(
    genls(c_refugeeinflux,c_individual) )).

fof(ax3_1907,axiom,(
    ! [OBJ] :
      ( refugeeinflux(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #653276:
fof(ax3_1908,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetunarypredicatemodaloperator(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1620008:
fof(ax3_1909,axiom,(
    genlmt(c_saicterrorismeventsdatamt,c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #771834:
fof(ax3_1910,axiom,(
    genlmt(c_pq126mt,c_basekb) )).

% Cyc Assertion #2185450:
fof(ax3_1911,axiom,(
    genlmt(c_tptp_member3629_mt,c_basekb) )).

% Cyc Assertion #395201:
fof(ax3_1912,axiom,(
    arg1isa(c_predexpansionlistfortype,c_collection) )).

fof(ax3_1913,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( predexpansionlistfortype(ARG1,ARG2,ARG3)
     => collection(ARG1) ) )).

% Cyc Assertion #288444:
fof(ax3_1914,axiom,(
    genlmt(c_cblcycorprefrigeratormassemailsendingnodedefinitionmt,c_basekb) )).

% Cyc Assertion #367669:
fof(ax3_1915,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1662211:
fof(ax3_1916,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183018:
fof(ax3_1917,axiom,(
    genlmt(c_tptp_member3021_mt,c_basekb) )).

% Cyc Assertion #1877798:
fof(ax3_1918,axiom,(
    genls(c_tptpcol_9_22021,c_tptpcol_8_22020) )).

fof(ax3_1919,axiom,(
    ! [OBJ] :
      ( tptpcol_9_22021(OBJ)
     => tptpcol_8_22020(OBJ) ) )).

% Cyc Assertion #1249700:
fof(ax3_1920,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscript_o_ramacommovie_scriptsffour_friends_script_transcript_4html)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1513315:
fof(ax3_1921,axiom,(
    genls(c_sensorsystem,c_partiallytangible) )).

fof(ax3_1922,axiom,(
    ! [OBJ] :
      ( sensorsystem(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2510694:
fof(ax3_1923,axiom,
    ( mtvisible(c_tptpgeo_member7_mt)
   => borderson(c_georegion_l4_x27_y64,c_georegion_l4_x27_y65) )).

% Cyc Assertion #752560:
fof(ax3_1924,axiom,(
    genlmt(c_pq211mt,c_testvocabularymt) )).

% Cyc Assertion #710953:
fof(ax3_1925,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwecbakersfieldorgdefendingourselves4doc)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #152956:
fof(ax3_1926,axiom,(
    genls(c_perspectivemicrotheory,c_microtheory) )).

fof(ax3_1927,axiom,(
    ! [OBJ] :
      ( perspectivemicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #2180242:
fof(ax3_1928,axiom,(
    genlmt(c_tptp_member2327_mt,c_basekb) )).

% Cyc Assertion #2463142:
fof(ax3_1929,axiom,(
    genlmt(c_tptpgeo_member2_mt,c_tptpgeo_spindleheadmt) )).

% Cyc Assertion #1441240:
fof(ax3_1930,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhgtvcomhgtvrm_restoration_homes_areasarticle01797hgtv_3787_137528800html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2177430:
fof(ax3_1931,axiom,(
    genlmt(c_tptp_member1624_mt,c_basekb) )).

% Cyc Assertion #1280135:
fof(ax3_1932,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_icteessideicnetworkcouklifestylehealthtodaytm_objectid15441850methodfullsiteid50081headlinecoping_with_life_in_a_dark_silent_world_name_pagehtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2482862:
fof(ax3_1933,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x60_y62) )).

% Cyc Assertion #2176298:
fof(ax3_1934,axiom,(
    genlmt(c_tptp_member1341_mt,c_basekb) )).

% Cyc Assertion #612894:
fof(ax3_1935,axiom,(
    genls(c_geographicalregion,c_partiallytangible) )).

fof(ax3_1936,axiom,(
    ! [OBJ] :
      ( geographicalregion(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #416133:
fof(ax3_1937,axiom,(
    genls(c_abstractthing,c_aspatialthing) )).

fof(ax3_1938,axiom,(
    ! [OBJ] :
      ( abstractthing(OBJ)
     => aspatialthing(OBJ) ) )).

% Cyc Assertion #210598:
fof(ax3_1939,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtopsynergycomfamousmichael_douglasasp)),c_translation_29),c_basekb) )).

% Cyc Assertion #978920:
fof(ax3_1940,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwelseroadcomntchronology_of_the_nthtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #2478078:
fof(ax3_1941,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x1_y57) )).

% Cyc Assertion #1251475:
fof(ax3_1942,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoldpathscomarchivesouthernpaul1901cor2html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #558104:
fof(ax3_1943,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_presidentaristotleblogspotcom2005_05_01_presidentaristotle_archivehtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #606026:
fof(ax3_1944,axiom,(
    ! [OBJ] :
      ( collectionsubsetfnfueltankthesetoftankandisatankfixedstructurerelationinstanceexistsin_contgenerictankgasolinefuel(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #738799:
fof(ax3_1945,axiom,(
    genls(c_iamicrotheory,c_microtheory) )).

fof(ax3_1946,axiom,(
    ! [OBJ] :
      ( iamicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #1137379:
fof(ax3_1947,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(c_observer_formal,c_employees,c_unitednationsorganization))
     => partiallytangible(OBJ) ) )).

fof(ax3_1948,axiom,(
    genls(f_subcollectionofwithrelationfromfn(c_observer_formal,c_employees,c_unitednationsorganization),c_partiallytangible) )).

fof(ax3_1949,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnobserver_formalemployeesunitednationsorganization(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #299806:
fof(ax3_1950,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_facilitytypeoforganizationtypefn(c_longtermmedicalcareprovidingorganization))
     => partiallytangible(OBJ) ) )).

fof(ax3_1951,axiom,(
    genls(f_facilitytypeoforganizationtypefn(c_longtermmedicalcareprovidingorganization),c_partiallytangible) )).

fof(ax3_1952,axiom,(
    ! [OBJ] :
      ( facilitytypeoforganizationtypefnlongtermmedicalcareprovidingorganization(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1081526:
fof(ax3_1953,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrubylanecomshopsbluedolphinilistcscollectibles_booksid34html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1249698:
fof(ax3_1954,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdelfininternationalcom3dvd6htm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #891949:
fof(ax3_1955,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_entityattributetype_ks),c_basekb) )).

% Cyc Assertion #523119:
fof(ax3_1956,axiom,(
    genlmt(f_contextofpcwfn(c_civillawsystem),c_basekb) )).

% Cyc Assertion #1278188:
fof(ax3_1957,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfuntriviacomplayquizcfmqid60926origin)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1049186:
fof(ax3_1958,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_worldtimesclick4commainaspxcountry236))) )).

% Cyc Assertion #2173726:
fof(ax3_1959,axiom,(
    genlmt(c_tptp_member698_mt,c_basekb) )).

% Cyc Assertion #2182962:
fof(ax3_1960,axiom,(
    genlmt(c_tptp_member3007_mt,c_basekb) )).

% Cyc Assertion #1123542:
fof(ax3_1961,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_ohmbnetshowthreadphpsf849b1044aabd53d3a0d62ef1930d5dagotolastpostforumid20)),c_translation_32),c_basekb) )).

% Cyc Assertion #337759:
fof(ax3_1962,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #722014:
fof(ax3_1963,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_22),c_basekb) )).

% Cyc Assertion #1074463:
fof(ax3_1964,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_greece))
     => individual(OBJ) ) )).

fof(ax3_1965,axiom,(
    genls(f_residentfn(c_greece),c_individual) )).

fof(ax3_1966,axiom,(
    ! [OBJ] :
      ( residentfngreece(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #766385:
fof(ax3_1967,axiom,(
    genls(c_microscopicsized_objecttype,c_collection) )).

fof(ax3_1968,axiom,(
    ! [OBJ] :
      ( microscopicsized_objecttype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #484590:
fof(ax3_1969,axiom,(
    genls(c_eonodedefined,c_aspatialinformationstore) )).

fof(ax3_1970,axiom,(
    ! [OBJ] :
      ( eonodedefined(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #812208:
fof(ax3_1971,axiom,(
    genlmt(c_genformattemplatemt,c_basekb) )).

% Cyc Assertion #1321287:
fof(ax3_1972,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_business,c_providerofservice,c_digitalsatellitetvbroadcasting))
     => individual(OBJ) ) )).

fof(ax3_1973,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_business,c_providerofservice,c_digitalsatellitetvbroadcasting),c_individual) )).

fof(ax3_1974,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnbusinessproviderofservicedigitalsatellitetvbroadcasting(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1253698:
fof(ax3_1975,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_moisesefaradorgbelsefphpid398)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #928937:
fof(ax3_1976,axiom,(
    genls(c_lotofland,c_geographicalregion) )).

fof(ax3_1977,axiom,(
    ! [OBJ] :
      ( lotofland(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1404070:
fof(ax3_1978,axiom,(
    genls(c_attentiondeficithyperactivitydisorder,c_individual) )).

fof(ax3_1979,axiom,(
    ! [OBJ] :
      ( attentiondeficithyperactivitydisorder(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1322574:
fof(ax3_1980,axiom,(
    individual(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwavontyrescomusensafetytiresafetyinstructionsasp)),c_translation_30)) )).

% Cyc Assertion #279918:
fof(ax3_1981,axiom,(
    genlmt(c_unitedstateshistorymt,c_humansociallifemt) )).

% Cyc Assertion #356383:
fof(ax3_1982,axiom,(
    genlmt(f_contextofpcwfn(c_newsreport_releaseofarunchand_webpage),c_basekb) )).

% Cyc Assertion #581890:
fof(ax3_1983,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_24),c_basekb) )).

% Cyc Assertion #165827:
fof(ax3_1984,axiom,(
    genlmt(c_saicalqaidadatamt,c_basekb) )).

% Cyc Assertion #2175782:
fof(ax3_1985,axiom,(
    genlmt(c_tptp_member1212_mt,c_basekb) )).

% Cyc Assertion #2117953:
fof(ax3_1986,axiom,(
    genls(c_tptpcol_11_118084,c_tptpcol_10_118020) )).

fof(ax3_1987,axiom,(
    ! [OBJ] :
      ( tptpcol_11_118084(OBJ)
     => tptpcol_10_118020(OBJ) ) )).

% Cyc Assertion #410846:
fof(ax3_1988,axiom,(
    genlmt(f_interpretingdocumentmtfn(c_exemplarlearnbyreadingdocument),c_basekb) )).

% Cyc Assertion #1580581:
fof(ax3_1989,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomben20hecht)),c_translation_31),c_basekb) )).

% Cyc Assertion #1322220:
fof(ax3_1990,axiom,(
    transitivebinarypredicate(c_genlmt) )).

% Cyc Assertion #698808:
fof(ax3_1991,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2178714:
fof(ax3_1992,axiom,(
    genlmt(c_tptp_member1945_mt,c_basekb) )).

% Cyc Assertion #2340984:
fof(ax3_1993,axiom,(
    individual(c_tptptptpcol_16_16129) )).

% Cyc Assertion #2181694:
fof(ax3_1994,axiom,(
    genlmt(c_tptp_member2690_mt,c_basekb) )).

% Cyc Assertion #1624086:
fof(ax3_1995,axiom,(
    genlmt(c_ehbthighlightsintermediatevocabmt,c_basekb) )).

% Cyc Assertion #555461:
fof(ax3_1996,axiom,(
    genlmt(c_wamt_modevalinitial_p10,c_basekb) )).

% Cyc Assertion #1113317:
fof(ax3_1997,axiom,(
    genlmt(c_paraphrasemt,c_basekb) )).

% Cyc Assertion #1185720:
fof(ax3_1998,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcog7orgbaimagesbajune05_engpdf)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #593130:
fof(ax3_1999,axiom,(
    genlmt(c_additionaltemplatesmt,c_basekb) )).

% Cyc Assertion #961220:
fof(ax3_2000,axiom,(
    uniformresourceidentifier(f_urifn(s_http_wwwkarmicastrocomosama_bin_ladenhtm)) )).

% Cyc Assertion #1456178:
fof(ax3_2001,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_sendpackage,c_individual,s_340a5863_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_2002,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_sendpackage,c_individual,s_340a5863_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_2003,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarysendpackageindividual340a5863_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1395266:
fof(ax3_2004,axiom,(
    genls(c_opaque,c_partiallytangible) )).

fof(ax3_2005,axiom,(
    ! [OBJ] :
      ( opaque(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #574436:
fof(ax3_2006,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwggggcombestdvd2owrif4r62feuhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #471076:
fof(ax3_2007,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_takecharge,c_individual,s_341ea3b0_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_2008,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_takecharge,c_individual,s_341ea3b0_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_2009,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarytakechargeindividual341ea3b0_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #399959:
fof(ax3_2010,axiom,(
    genlmt(c_universalvocabularymt,c_basekb) )).

% Cyc Assertion #867643:
fof(ax3_2011,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmesothelioma__lawyercomstatewashingtonhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1492349:
fof(ax3_2012,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcanoecajammoviesartistsppreston_kellyhtml)),c_translation_26),c_basekb) )).

% Cyc Assertion #2184062:
fof(ax3_2013,axiom,(
    genlmt(c_tptp_member3282_mt,c_basekb) )).

% Cyc Assertion #2245311:
fof(ax3_2014,axiom,(
    genlmt(c_tptpsksischematranslationmicrotheory,c_basekb) )).

% Cyc Assertion #458826:
fof(ax3_2015,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_priceseekeryo_storecompssling_blade)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #328505:
fof(ax3_2016,axiom,(
    genlmt(c_lexiconextensionhypothesismt,c_basekb) )).

% Cyc Assertion #1078859:
fof(ax3_2017,axiom,(
    genlmt(c_socreport_fbi_20030418_reportcontent,c_basekb) )).

% Cyc Assertion #1311832:
fof(ax3_2018,axiom,(
    genls(c_softwaretestortype,c_thing) )).

fof(ax3_2019,axiom,(
    ! [OBJ] :
      ( softwaretestortype(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1794000:
fof(ax3_2020,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1683918:
fof(ax3_2021,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordmoonstruckoffset0)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #958102:
fof(ax3_2022,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_minnesota_state))
     => individual(OBJ) ) )).

fof(ax3_2023,axiom,(
    genls(f_residentfn(c_minnesota_state),c_individual) )).

fof(ax3_2024,axiom,(
    ! [OBJ] :
      ( residentfnminnesota_state(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1125382:
fof(ax3_2025,axiom,(
    individual(f_citynamedfn(s_losalamos,c_newmexico_state)) )).

% Cyc Assertion #1480146:
fof(ax3_2026,axiom,(
    ! [OBJ] :
      ( collectiondefinedbyfnsublquotefncyc_subl_query_property_p(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #228658:
fof(ax3_2027,axiom,
    ( mtvisible(c_externalontologyprojectsmt)
   => genls(c_eonodeignored,c_aspatialinformationstore) )).

fof(ax3_2028,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_externalontologyprojectsmt)
        & eonodeignored(OBJ) )
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1567034:
fof(ax3_2029,axiom,(
    genlmt(c_artifactgmt,c_basekb) )).

% Cyc Assertion #1403430:
fof(ax3_2030,axiom,(
    genlmt(c_wamt_evalinitial_p12,c_basekb) )).

% Cyc Assertion #482712:
fof(ax3_2031,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_17),c_basekb) )).

% Cyc Assertion #403341:
fof(ax3_2032,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(c_individual,c_parts,c_grantwood))
     => individual(OBJ) ) )).

fof(ax3_2033,axiom,(
    genls(f_subcollectionofwithrelationfromfn(c_individual,c_parts,c_grantwood),c_individual) )).

fof(ax3_2034,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnindividualpartsgrantwood(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1312491:
fof(ax3_2035,axiom,(
    genls(c_medicalleave_timeallocation_8,c_individual) )).

fof(ax3_2036,axiom,(
    ! [OBJ] :
      ( medicalleave_timeallocation_8(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #473088:
fof(ax3_2037,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjfk_onlinecomjfk100bigjimhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #700634:
fof(ax3_2038,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentfilm4009157stm)),c_translation_25),c_basekb) )).

% Cyc Assertion #1066502:
fof(ax3_2039,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(f_evaluationofslotvaluefn(c_hypothesismtconfidence),c_evaluee_direct,c_semanticinterpretationhypothesismicrotheory_sentencelevel))
     => individual(OBJ) ) )).

fof(ax3_2040,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(f_evaluationofslotvaluefn(c_hypothesismtconfidence),c_evaluee_direct,c_semanticinterpretationhypothesismicrotheory_sentencelevel),c_individual) )).

fof(ax3_2041,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnevaluationofslotvaluefnhypothesismtconfidenceevaluee_directsemanticinterpretationhypothesismicrotheory_sentencelevel(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2186258:
fof(ax3_2042,axiom,(
    genlmt(c_tptp_member3831_mt,c_basekb) )).

% Cyc Assertion #2181151:
fof(ax3_2043,axiom,(
    genlmt(c_tptp_member2554_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #420569:
fof(ax3_2044,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2068514:
fof(ax3_2045,axiom,(
    genls(c_tptpcol_4_98306,c_tptpcol_3_98305) )).

fof(ax3_2046,axiom,(
    ! [OBJ] :
      ( tptpcol_4_98306(OBJ)
     => tptpcol_3_98305(OBJ) ) )).

% Cyc Assertion #768020:
fof(ax3_2047,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfactmonstercomipkaa0761438html)),c_translation_7),c_basekb) )).

% Cyc Assertion #1612897:
fof(ax3_2048,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_facilitytypeoforganizationtypefn(c_arcade))
     => partiallytangible(OBJ) ) )).

fof(ax3_2049,axiom,(
    genls(f_facilitytypeoforganizationtypefn(c_arcade),c_partiallytangible) )).

fof(ax3_2050,axiom,(
    ! [OBJ] :
      ( facilitytypeoforganizationtypefnarcade(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #640409:
fof(ax3_2051,axiom,(
    genls(c_acipconstant,c_thing) )).

fof(ax3_2052,axiom,(
    ! [OBJ] :
      ( acipconstant(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #845481:
fof(ax3_2053,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasgcomdw)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182970:
fof(ax3_2054,axiom,(
    genlmt(c_tptp_member3009_mt,c_basekb) )).

% Cyc Assertion #136709:
fof(ax3_2055,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_collegehmcocomhistoryreaderscompgahffhtmlff_103400_jonesjameseahtm)),c_translation_0),c_basekb) )).

% Cyc Assertion #1761111:
fof(ax3_2056,axiom,(
    genls(c_cyccomponentparametervalue,c_aspatialinformationstore) )).

fof(ax3_2057,axiom,(
    ! [OBJ] :
      ( cyccomponentparametervalue(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #2289850:
fof(ax3_2058,axiom,
    ( mtvisible(c_tptp_spindleheadmt)
   => shavingrazor_manual(c_tptpshavingrazor_manual_2) )).

% Cyc Assertion #2180986:
fof(ax3_2059,axiom,(
    genlmt(c_tptp_member2513_mt,c_basekb) )).

% Cyc Assertion #186890:
fof(ax3_2060,axiom,(
    genls(c_mineralfield,c_geographicalregion) )).

fof(ax3_2061,axiom,(
    ! [OBJ] :
      ( mineralfield(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1178570:
fof(ax3_2062,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjamieleecurtisoffset0)),c_translation_32),c_basekb) )).

% Cyc Assertion #752701:
fof(ax3_2063,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1622589:
fof(ax3_2064,axiom,(
    genlmt(f_contextofpcwfn(c_nuclearnonproliferationtreaty),c_basekb) )).

% Cyc Assertion #1665109:
fof(ax3_2065,axiom,(
    ! [OBJ] :
      ( protectingfncollectionsubsetfnoffshoreoilplatformthesetofplatformandobjectfoundinlocationplatformpersiangulfownsunitedarabemiratesplatform(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1763838:
fof(ax3_2066,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_3),c_basekb) )).

% Cyc Assertion #1496539:
fof(ax3_2067,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwalbanynetlauraleearqhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #753772:
fof(ax3_2068,axiom,(
    genls(c_tangibleobjecttypebygenericdamage_nonscalar,c_collection) )).

fof(ax3_2069,axiom,(
    ! [OBJ] :
      ( tangibleobjecttypebygenericdamage_nonscalar(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1206421:
fof(ax3_2070,axiom,(
    genlmt(c_persiangulfwarmt,c_basekb) )).

% Cyc Assertion #509516:
fof(ax3_2071,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfarsinetcompersiansinbibleimageschap3epdf)),c_translation_33),c_basekb) )).

% Cyc Assertion #1476402:
fof(ax3_2072,axiom,(
    genlmt(c_reasoningaboutcoreferentexpressionsmt,c_basekb) )).

% Cyc Assertion #967087:
fof(ax3_2073,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_filmguardiancoukfeature_storyobserver041202538500html)),c_translation_8),c_basekb) )).

% Cyc Assertion #630199:
fof(ax3_2074,axiom,(
    genlmt(c_spanishdancerinparadeimt,c_basekb) )).

% Cyc Assertion #1688183:
fof(ax3_2075,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrevolutionsfcomarticlehtmlid1281)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #326401:
fof(ax3_2076,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive20040915n61crtr29jarhtm)),c_translation_1),c_basekb) )).

% Cyc Assertion #399015:
fof(ax3_2077,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_reviewsauthorstorecom200504an_anonymous_auhtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #1260100:
fof(ax3_2078,axiom,
    ( mtvisible(c_languageandwritingsystemvocabularymt)
   => livinglanguage(c_chipewyanlanguage) )).

% Cyc Assertion #1329640:
fof(ax3_2079,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_17),c_basekb) )).

% Cyc Assertion #1069434:
fof(ax3_2080,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_15),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1140200:
fof(ax3_2081,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfree_researchpaperscomdbsa3bqg32shtml)),c_translation_15),c_basekb) )).

% Cyc Assertion #1023962:
fof(ax3_2082,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_source_ks),c_basekb) )).

% Cyc Assertion #1659207:
fof(ax3_2083,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_foodservingfn(f_subcollectionofwithrelationtofn(f_subcollectionofwithrelationtofn(c_primerib_meatcut,c_derivedfrom,c_blackanguscattle),c_haspreparationstyle,c_slowlyroasted)))
     => partiallytangible(OBJ) ) )).

fof(ax3_2084,axiom,(
    genls(f_foodservingfn(f_subcollectionofwithrelationtofn(f_subcollectionofwithrelationtofn(c_primerib_meatcut,c_derivedfrom,c_blackanguscattle),c_haspreparationstyle,c_slowlyroasted)),c_partiallytangible) )).

fof(ax3_2085,axiom,(
    ! [OBJ] :
      ( foodservingfnsubcollectionofwithrelationtofnsubcollectionofwithrelationtofnprimerib_meatcutderivedfromblackanguscattlehaspreparationstyleslowlyroasted(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #965948:
fof(ax3_2086,axiom,(
    genlmt(c_keinteractionresourcetestmt,c_gkeformulatemplatesmt) )).

% Cyc Assertion #2176790:
fof(ax3_2087,axiom,(
    genlmt(c_tptp_member1464_mt,c_basekb) )).

% Cyc Assertion #1154652:
fof(ax3_2088,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_westernamericanablogspotcom200511tackling_new_frontier_in_filmhtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #158003:
fof(ax3_2089,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_billardshall,c_partiallytangible,s_341c59c1_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_2090,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_billardshall,c_partiallytangible,s_341c59c1_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_2091,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarybillardshallpartiallytangible341c59c1_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1701723:
fof(ax3_2092,axiom,(
    genls(c_mediumearthorbit,c_partiallytangible) )).

fof(ax3_2093,axiom,(
    ! [OBJ] :
      ( mediumearthorbit(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1133800:
fof(ax3_2094,axiom,(
    genlmt(c_relationparaphrasemt,c_basekb) )).

% Cyc Assertion #2176106:
fof(ax3_2095,axiom,(
    genlmt(c_tptp_member1293_mt,c_basekb) )).

% Cyc Assertion #1296168:
fof(ax3_2096,axiom,(
    genlmt(c_rwinstance4mt,c_basekb) )).

% Cyc Assertion #886713:
fof(ax3_2097,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtodayinliteraturecombiographyarthurmillerasp)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #356343:
fof(ax3_2098,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordozoffset0)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #562803:
fof(ax3_2099,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_eightball,c_thing,s_341bbd82_f4ed_11d9_9bea_0002b3a85b0b))
     => thing(OBJ) ) )).

fof(ax3_2100,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_eightball,c_thing,s_341bbd82_f4ed_11d9_9bea_0002b3a85b0b),c_thing) )).

fof(ax3_2101,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryeightballthing341bbd82_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1609817:
fof(ax3_2102,axiom,(
    genlmt(c_reportonconstructionexcavationincidentmt,c_basekb) )).

% Cyc Assertion #1240342:
fof(ax3_2103,axiom,(
    genlmt(f_contentmtfn(c_glassbox_analyst_tasking_ks),c_basekb) )).

% Cyc Assertion #1797502:
fof(ax3_2104,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1285297:
fof(ax3_2105,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),c_researchiraniandissent,c_nooescape_theprogram),c_basekb) )).

% Cyc Assertion #393405:
fof(ax3_2106,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentshowbiz2987670stm)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1642387:
fof(ax3_2107,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthedailybulletincompostcardsmar9chtm)),c_translation_9),c_basekb) )).

% Cyc Assertion #1408161:
fof(ax3_2108,axiom,(
    genlmt(c_uia_killingolegvagenmt,c_basekb) )).

% Cyc Assertion #862545:
fof(ax3_2109,axiom,(
    genlmt(c_housereport105_851mt,c_basekb) )).

% Cyc Assertion #1573100:
fof(ax3_2110,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_mapfn_individual(f_northernregionfn(f_westernregionfn(c_bosnia_herzegovina))))
     => individual(OBJ) ) )).

fof(ax3_2111,axiom,(
    genls(f_mapfn_individual(f_northernregionfn(f_westernregionfn(c_bosnia_herzegovina))),c_individual) )).

fof(ax3_2112,axiom,(
    ! [OBJ] :
      ( mapfn_individualnorthernregionfnwesternregionfnbosnia_herzegovina(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1494302:
fof(ax3_2113,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmkbmemorialcominterviewsinvitedtalktrans)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #880074:
fof(ax3_2114,axiom,(
    genlmt(c_saicbioterrorismeventsdatamt,c_currentworlddatacollectormt_nonhomocentric) )).

% Cyc Assertion #182624:
fof(ax3_2115,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetcetaceanfish(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1601600:
fof(ax3_2116,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_indianzcomnews2004003175asp)),c_translation_33),c_basekb) )).

% Cyc Assertion #1791344:
fof(ax3_2117,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreadiocomarchives030205bbroadway5html)),c_translation_0),c_basekb) )).

% Cyc Assertion #347958:
fof(ax3_2118,axiom,
    ( mtvisible(c_modalitymt)
   => gen_commutativity_disj(c_necessary) )).

% Cyc Assertion #528595:
fof(ax3_2119,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_22),c_basekb) )).

% Cyc Assertion #2171166:
fof(ax3_2120,axiom,(
    genlmt(c_tptp_member58_mt,c_basekb) )).

% Cyc Assertion #933075:
fof(ax3_2121,axiom,(
    genls(c_canonzr_theproductversion,c_individual) )).

fof(ax3_2122,axiom,(
    ! [OBJ] :
      ( canonzr_theproductversion(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #500855:
fof(ax3_2123,axiom,(
    genls(c_phaseline,c_geographicalregion) )).

fof(ax3_2124,axiom,(
    ! [OBJ] :
      ( phaseline(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1748554:
fof(ax3_2125,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_32),c_basekb) )).

% Cyc Assertion #217943:
fof(ax3_2126,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_geographicalregion,c_objectfoundinlocation,f_mobfn(c_lake)))
     => geographicalregion(OBJ) ) )).

fof(ax3_2127,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_geographicalregion,c_objectfoundinlocation,f_mobfn(c_lake)),c_geographicalregion) )).

fof(ax3_2128,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefngeographicalregionobjectfoundinlocationmobfnlake(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #945329:
fof(ax3_2129,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwglobalsecurityorgmilitarylibrarynews200202mil_020215_dod02htm)),c_translation_0),c_basekb) )).

% Cyc Assertion #993356:
fof(ax3_2130,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_14),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1456945:
fof(ax3_2131,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmegaessayscomviewpaper83347html)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1547400:
fof(ax3_2132,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_northwestdepartment_haiti) )).

% Cyc Assertion #1399318:
fof(ax3_2133,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororghwebpeoplewwayne_lindacanada_righthtml)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #576345:
fof(ax3_2134,axiom,(
    genls(c_absm10hovercraft,c_individual) )).

fof(ax3_2135,axiom,(
    ! [OBJ] :
      ( absm10hovercraft(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #395622:
fof(ax3_2136,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_27),c_basekb) )).

% Cyc Assertion #1593800:
fof(ax3_2137,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdiscoverourtowncomtownpagephptown105catattractions)),c_translation_31),c_basekb) )).

% Cyc Assertion #621191:
fof(ax3_2138,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_strikeatapoliticalrallygrenademissedandhitagroupofprivatecitizensinstead,c_actiononobject,s_341729a0_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_2139,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_strikeatapoliticalrallygrenademissedandhitagroupofprivatecitizensinstead,c_actiononobject,s_341729a0_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_2140,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarystrikeatapoliticalrallygrenademissedandhitagroupofprivatecitizensinsteadactiononobject341729a0_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1466867:
fof(ax3_2141,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richmondthenandnowcomfamous_people_richmond_4html)),c_translation_30),c_basekb) )).

% Cyc Assertion #739745:
fof(ax3_2142,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpeterfordcombiohtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #226310:
fof(ax3_2143,axiom,(
    genlmt(c_climbingrockfaceimt,c_basekb) )).

% Cyc Assertion #1486468:
fof(ax3_2144,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwabsoluteastronomycomencyclopediammimichael_douglashtm)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2422040:
fof(ax3_2145,axiom,(
    individual(c_tptpncollectionintersection2fnairtransportationdeviceexperimental_5) )).

% Cyc Assertion #1631512:
fof(ax3_2146,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcardiffacukcymraegenglishstudycardiffcapitalcityshtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183458:
fof(ax3_2147,axiom,(
    genlmt(c_tptp_member3131_mt,c_basekb) )).

% Cyc Assertion #2364046:
fof(ax3_2148,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member697_mt)
        & isa(INS,f_groupfn(c_fjord)) )
     => tptpofobject(INS,f_tptpquantityfn_13(n_518)) ) )).

fof(ax3_2149,axiom,
    ( mtvisible(c_tptp_member697_mt)
   => relationallinstance(c_tptpofobject,f_groupfn(c_fjord),f_tptpquantityfn_13(n_518)) )).

% Cyc Assertion #2463162:
fof(ax3_2150,axiom,(
    genlmt(c_tptpgeo_member7_mt,c_tptpgeo_spindleheadmt) )).

% Cyc Assertion #2172974:
fof(ax3_2151,axiom,(
    genlmt(c_tptp_member510_mt,c_basekb) )).

% Cyc Assertion #1611501:
fof(ax3_2152,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplecchristiedougftppypeoplecchristiedougcanadaright)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1737008:
fof(ax3_2153,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_newspaper_new_york_times_the_march_15_2006),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #273715:
fof(ax3_2154,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnndbcompeople243000025168)),c_translation_2),c_basekb) )).

% Cyc Assertion #299086:
fof(ax3_2155,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1127601:
fof(ax3_2156,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewscorpcomreport2000filmed_ent2html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1717680:
fof(ax3_2157,axiom,(
    genlmt(c_oastatuscheckergraphmt,c_basekb) )).

% Cyc Assertion #985870:
fof(ax3_2158,axiom,(
    genls(c_plutonium_240,c_partiallytangible) )).

fof(ax3_2159,axiom,(
    ! [OBJ] :
      ( plutonium_240(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1693924:
fof(ax3_2160,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordarnoldschwarzeneggeroffset0)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1890058:
fof(ax3_2161,axiom,(
    genls(c_tptpcol_16_26927,c_tptpcol_15_26925) )).

fof(ax3_2162,axiom,(
    ! [OBJ] :
      ( tptpcol_16_26927(OBJ)
     => tptpcol_15_26925(OBJ) ) )).

% Cyc Assertion #320502:
fof(ax3_2163,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviehabitcomhandheldessayscoffee_talk_04hhphp)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #627195:
fof(ax3_2164,axiom,(
    genlmt(c_strategicassessment1997mt,c_hpkbvocabmt) )).

% Cyc Assertion #747860:
fof(ax3_2165,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtehtm)),c_translation_26),c_basekb) )).

% Cyc Assertion #1030061:
fof(ax3_2166,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmtsuedusocworkfrostgodmohicanshtm)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #490284:
fof(ax3_2167,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_32),c_basekb) )).

% Cyc Assertion #2479083:
fof(ax3_2168,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x14_y9) )).

% Cyc Assertion #170040:
fof(ax3_2169,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamb_usafrresourcesfranceusfamericans3htm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1361914:
fof(ax3_2170,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_20),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1711130:
fof(ax3_2171,axiom,(
    genls(c_pfizerantiarrhythmiamarket,c_individual) )).

fof(ax3_2172,axiom,(
    ! [OBJ] :
      ( pfizerantiarrhythmiamarket(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2177206:
fof(ax3_2173,axiom,(
    genlmt(c_tptp_member1568_mt,c_basekb) )).

% Cyc Assertion #642114:
fof(ax3_2174,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmetafiltercommefi45676)),c_translation_1),c_basekb) )).

% Cyc Assertion #2478084:
fof(ax3_2175,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x1_y63) )).

% Cyc Assertion #695360:
fof(ax3_2176,axiom,(
    genlmt(f_mappingmtfn(c_sxsw2003_ks),c_basekb) )).

% Cyc Assertion #694912:
fof(ax3_2177,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommfhtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #379041:
fof(ax3_2178,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwallmovieportalcomm1997_shine62html)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1556839:
fof(ax3_2179,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #180587:
fof(ax3_2180,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordmegryanoffset0)),c_translation_31),c_basekb) )).

% Cyc Assertion #1416625:
fof(ax3_2181,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwzeppscommentariescomvrwcmillerhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #555406:
fof(ax3_2182,axiom,(
    genls(c_scoringsoftwarestrategy,c_individual) )).

fof(ax3_2183,axiom,(
    ! [OBJ] :
      ( scoringsoftwarestrategy(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1470637:
fof(ax3_2184,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2477127:
fof(ax3_2185,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_1(c_georegion_l1_x2_y0) )).

% Cyc Assertion #881790:
fof(ax3_2186,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enmimihustarsmatt_dillonhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1607650:
fof(ax3_2187,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_14),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1635218:
fof(ax3_2188,axiom,(
    genlmt(c_unitedstatessociallifemt,c_organizationmt) )).

% Cyc Assertion #2512239:
fof(ax3_2189,axiom,
    ( mtvisible(c_tptpgeo_member4_mt)
   => borderson(c_georegion_l4_x37_y49,c_georegion_l4_x37_y50) )).

% Cyc Assertion #827233:
fof(ax3_2190,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cheerleaderyozcomarchives001947html)),c_translation_32),c_basekb) )).

% Cyc Assertion #2176198:
fof(ax3_2191,axiom,(
    genlmt(c_tptp_member1316_mt,c_basekb) )).

% Cyc Assertion #1612675:
fof(ax3_2192,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomhis20girl20friday)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2081738:
fof(ax3_2193,axiom,(
    firstordercollection(c_tptpcol_14_103599) )).

% Cyc Assertion #1418934:
fof(ax3_2194,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesettwodimensionalthinglinearobject(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1923831:
fof(ax3_2195,axiom,(
    genls(c_tptpcol_13_40436,c_tptpcol_12_40420) )).

fof(ax3_2196,axiom,(
    ! [OBJ] :
      ( tptpcol_13_40436(OBJ)
     => tptpcol_12_40420(OBJ) ) )).

% Cyc Assertion #739886:
fof(ax3_2197,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadianftppyorgscanadianchurch_of_the_creatorcanadaright)),c_translation_7),c_basekb) )).

% Cyc Assertion #358289:
fof(ax3_2198,axiom,(
    genlmt(f_lexicalmtforlanguagefn(c_russianlanguage),c_basekb) )).

% Cyc Assertion #2185274:
fof(ax3_2199,axiom,(
    genlmt(c_tptp_member3585_mt,c_basekb) )).

% Cyc Assertion #608168:
fof(ax3_2200,axiom,(
    genlmt(c_cycorpproductsmt,c_kerelevance_basedinterestingnessrulesmt) )).

% Cyc Assertion #583342:
fof(ax3_2201,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_database_cia_world_factbook_2005),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #757554:
fof(ax3_2202,axiom,(
    genls(c_feminineobject,c_individual) )).

fof(ax3_2203,axiom,(
    ! [OBJ] :
      ( feminineobject(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2172486:
fof(ax3_2204,axiom,(
    genlmt(c_tptp_member388_mt,c_basekb) )).

% Cyc Assertion #1593810:
fof(ax3_2205,axiom,(
    genlmt(c_functionalroleanalysismt,c_basekb) )).

% Cyc Assertion #748840:
fof(ax3_2206,axiom,(
    genls(c_issue,c_intangibleindividual) )).

fof(ax3_2207,axiom,(
    ! [OBJ] :
      ( issue(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #455528:
fof(ax3_2208,axiom,(
    transitivebinarypredicate(c_genls) )).

% Cyc Assertion #526366:
fof(ax3_2209,axiom,(
    genlmt(f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1994))),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #1093531:
fof(ax3_2210,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrubylanecomshopsbluedolphinilistcscollectibles_booksid34html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1329273:
fof(ax3_2211,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrockiesnetspiritsermonsa_or32_jsphp)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1605907:
fof(ax3_2212,axiom,(
    genls(c_softwaretestortypeversion,c_thing) )).

fof(ax3_2213,axiom,(
    ! [OBJ] :
      ( softwaretestortypeversion(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #911407:
fof(ax3_2214,axiom,(
    genls(c_persontypebycreditcardpaymenttendency,c_collection) )).

fof(ax3_2215,axiom,(
    ! [OBJ] :
      ( persontypebycreditcardpaymenttendency(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #685543:
fof(ax3_2216,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(c_militaryperson,c_hasmembers,f_armedforcesfn(c_unitedstatesofamerica)))
     => militaryperson(OBJ) ) )).

fof(ax3_2217,axiom,(
    genls(f_subcollectionofwithrelationfromfn(c_militaryperson,c_hasmembers,f_armedforcesfn(c_unitedstatesofamerica)),c_militaryperson) )).

fof(ax3_2218,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnmilitarypersonhasmembersarmedforcesfnunitedstatesofamerica(OBJ)
     => militaryperson(OBJ) ) )).

% Cyc Assertion #1018608:
fof(ax3_2219,axiom,(
    genlmt(c_socreport_fbi_20030420_reportcontent,c_basekb) )).

% Cyc Assertion #1676979:
fof(ax3_2220,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_sherlock_holmesbiographyms)),c_translation_0),c_basekb) )).

% Cyc Assertion #2180434:
fof(ax3_2221,axiom,(
    genlmt(c_tptp_member2375_mt,c_basekb) )).

% Cyc Assertion #967128:
fof(ax3_2222,axiom,(
    genls(c_rockysoilregion,c_geographicalregion) )).

fof(ax3_2223,axiom,(
    ! [OBJ] :
      ( rockysoilregion(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #794836:
fof(ax3_2224,axiom,(
    genlmt(c_basekb,c_cychistoricalpossibilitytheorymt) )).

% Cyc Assertion #2178726:
fof(ax3_2225,axiom,(
    genlmt(c_tptp_member1948_mt,c_basekb) )).

% Cyc Assertion #133761:
fof(ax3_2226,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dailyhaggiscomindexphp200402page2)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1215018:
fof(ax3_2227,axiom,(
    genls(c_pragmaticallydecontextualizedcollection,c_collection) )).

fof(ax3_2228,axiom,(
    ! [OBJ] :
      ( pragmaticallydecontextualizedcollection(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #2183242:
fof(ax3_2229,axiom,(
    genlmt(c_tptp_member3077_mt,c_basekb) )).

% Cyc Assertion #954323:
fof(ax3_2230,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom200508on_writinghtml)),c_translation_3),c_basekb) )).

% Cyc Assertion #476954:
fof(ax3_2231,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_8),c_basekb) )).

% Cyc Assertion #2177414:
fof(ax3_2232,axiom,(
    genlmt(c_tptp_member1620_mt,c_basekb) )).

% Cyc Assertion #2183182:
fof(ax3_2233,axiom,(
    genlmt(c_tptp_member3062_mt,c_basekb) )).

% Cyc Assertion #2179702:
fof(ax3_2234,axiom,(
    genlmt(c_tptp_member2192_mt,c_basekb) )).

% Cyc Assertion #990452:
fof(ax3_2235,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom200508on_writinghtml)),c_translation_6),c_basekb) )).

% Cyc Assertion #511443:
fof(ax3_2236,axiom,(
    genlmt(c_sksiqueryfoldermt,c_testvocabularymt) )).

% Cyc Assertion #1796874:
fof(ax3_2237,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_13),c_basekb) )).

% Cyc Assertion #1762414:
fof(ax3_2238,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwconservativeonlineorgnewsletterscts_newsletter_200205htm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1430156:
fof(ax3_2239,axiom,(
    individual(f_urlfn(s_http_wwwbestdtudksc96information_packagehtml)) )).

% Cyc Assertion #569384:
fof(ax3_2240,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwteenreadscomreviews0679751130asp)),c_translation_0),c_basekb) )).

% Cyc Assertion #479763:
fof(ax3_2241,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2095676:
fof(ax3_2242,axiom,(
    genls(c_tptpcol_14_109174,c_tptpcol_13_109173) )).

fof(ax3_2243,axiom,(
    ! [OBJ] :
      ( tptpcol_14_109174(OBJ)
     => tptpcol_13_109173(OBJ) ) )).

% Cyc Assertion #1071316:
fof(ax3_2244,axiom,(
    genlmt(c_datafornl_specialprojectsmt,c_basekb) )).

% Cyc Assertion #1411457:
fof(ax3_2245,axiom,(
    applicationcontext(c_bpv_redfiresmt) )).

% Cyc Assertion #605305:
fof(ax3_2246,axiom,(
    genlmt(f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1997))),c_keinteractionresourcetestmt) )).

% Cyc Assertion #1537743:
fof(ax3_2247,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_collectionintersection2fn(c_israeliperson,f_subcollectionofwithrelationtotypefn(c_personwithoccupation,c_worksatfacility,c_checkpoint_military)))
     => individual(OBJ) ) )).

fof(ax3_2248,axiom,(
    genls(f_collectionintersection2fn(c_israeliperson,f_subcollectionofwithrelationtotypefn(c_personwithoccupation,c_worksatfacility,c_checkpoint_military)),c_individual) )).

fof(ax3_2249,axiom,(
    ! [OBJ] :
      ( collectionintersection2fnisraelipersonsubcollectionofwithrelationtotypefnpersonwithoccupationworksatfacilitycheckpoint_military(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2181439:
fof(ax3_2250,axiom,(
    genlmt(c_tptp_member2626_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #599946:
fof(ax3_2251,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtehtm)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #841904:
fof(ax3_2252,axiom,(
    genlmt(c_socreport_si_20030420_reportcontent,c_basekb) )).

% Cyc Assertion #238104:
fof(ax3_2253,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpvponlinecomnewsproarchivesarc7_2003html)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1158017:
fof(ax3_2254,axiom,(
    arg2isa(c_mournsover,c_dyingofblo) )).

fof(ax3_2255,axiom,(
    ! [ARG1,ARG2] :
      ( mournsover(ARG1,ARG2)
     => dyingofblo(ARG2) ) )).

% Cyc Assertion #2358671:
fof(ax3_2256,axiom,(
    ! [INS] :
      ( ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
        & isa(INS,f_subcollectionofwithrelationfromtypefn(c_geographicalregion,c_geographicalsubregions,c_plain_topographical)) )
     => tptpofobject(INS,f_tptpquantityfn_8(n_794)) ) )).

fof(ax3_2257,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => relationallinstance(c_tptpofobject,f_subcollectionofwithrelationfromtypefn(c_geographicalregion,c_geographicalsubregions,c_plain_topographical),f_tptpquantityfn_8(n_794)) )).

% Cyc Assertion #224001:
fof(ax3_2258,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_filmguardiancoukfeature_storyobserver041202538500html)),c_translation_21),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1038166:
fof(ax3_2259,axiom,(
    genlmt(c_keinteractionresourcetestmt,c_testvocabularymt) )).

% Cyc Assertion #2185122:
fof(ax3_2260,axiom,(
    genlmt(c_tptp_member3547_mt,c_basekb) )).

% Cyc Assertion #482009:
fof(ax3_2261,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreadiocomarchives030205bbroadway5html)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1803524:
fof(ax3_2262,axiom,(
    genlmt(c_temporarylexicalassertions_paulsmt,c_basekb) )).

% Cyc Assertion #433455:
fof(ax3_2263,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentshowbiz2987670stm)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1335382:
fof(ax3_2264,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrtcolcomoaklandbrockhtml)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1270459:
fof(ax3_2265,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_b00005uo7fvglance)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1766599:
fof(ax3_2266,axiom,(
    genls(c_unicorn,c_individual) )).

fof(ax3_2267,axiom,(
    ! [OBJ] :
      ( unicorn(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1557107:
fof(ax3_2268,axiom,(
    genls(c_killingthroughburialalive,c_individual) )).

fof(ax3_2269,axiom,(
    ! [OBJ] :
      ( killingthroughburialalive(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1546891:
fof(ax3_2270,axiom,(
    genlmt(c_religiouspeopledatamt,c_gregoriancalendarmt) )).

% Cyc Assertion #2183734:
fof(ax3_2271,axiom,(
    genlmt(c_tptp_member3200_mt,c_basekb) )).

% Cyc Assertion #278062:
fof(ax3_2272,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webamnestyorglibraryindexengasa160121999openofeng_310)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #439264:
fof(ax3_2273,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtrikiwikicomgarry_marshall)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #529322:
fof(ax3_2274,axiom,(
    genlmt(c_uia_coabackgroundscenarioauthoring_demoenvironmentmt,c_basekb) )).

% Cyc Assertion #1567944:
fof(ax3_2275,axiom,(
    uniformresourcelocator(f_urlfn(s_http_wwwnwcncomartsandleisuredvdreleasesstoriesnw_011304etndvdreleaseslj11345ec0html)) )).

% Cyc Assertion #1623676:
fof(ax3_2276,axiom,(
    genlmt(c_terroristfinancedatabasesourcemt,c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #2173464:
fof(ax3_2277,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member632_mt) )).

% Cyc Assertion #1004760:
fof(ax3_2278,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_artsedgekennedy_centerorgcontent3498)),c_translation_12),c_basekb) )).

% Cyc Assertion #1362207:
fof(ax3_2279,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfwsgovendangerediasaa8dhtml)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #933579:
fof(ax3_2280,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetadultmalehumanmilitarypersonbritishperson(OBJ)
     => militaryperson(OBJ) ) )).

% Cyc Assertion #2504622:
fof(ax3_2281,axiom,
    ( mtvisible(c_tptpgeo_member2_mt)
   => inregion(c_geolocation_x76_y23,c_georegion_l4_x76_y23) )).

% Cyc Assertion #1671834:
fof(ax3_2282,axiom,
    ( mtvisible(c_computersoftwaredatamt)
   => unversionedprogram(c_mkpv_theprogram) )).

% Cyc Assertion #865563:
fof(ax3_2283,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrhdservicescomrhd20serviceshtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1694978:
fof(ax3_2284,axiom,(
    genlmt(c_umlproceduredefinition_performcyclmt,c_basekb) )).

% Cyc Assertion #1717630:
fof(ax3_2285,axiom,(
    transitivebinarypredicate(f_typicallycomparestowrtslotfn(c_lessthan,c_widthofobject)) )).

% Cyc Assertion #1677847:
fof(ax3_2286,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom2005_07_01_cycledog_archivehtml)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #694923:
fof(ax3_2287,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(f_seedfn(c_beanplant)))
     => partiallytangible(OBJ) ) )).

fof(ax3_2288,axiom,(
    genls(f_groupfn(f_seedfn(c_beanplant)),c_partiallytangible) )).

fof(ax3_2289,axiom,(
    ! [OBJ] :
      ( groupfnseedfnbeanplant(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #565547:
fof(ax3_2290,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwunityofanaheimorgccuprometheushtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #590561:
fof(ax3_2291,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_14),c_basekb) )).

% Cyc Assertion #676342:
fof(ax3_2292,axiom,(
    genlmt(c_cathynetworktestmt,c_basekb) )).

% Cyc Assertion #774914:
fof(ax3_2293,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_lisnewsorgmdoneiljournal)),c_translation_2),c_basekb) )).

% Cyc Assertion #2118430:
fof(ax3_2294,axiom,(
    genls(c_tptpcol_8_118274,c_tptpcol_7_117762) )).

fof(ax3_2295,axiom,(
    ! [OBJ] :
      ( tptpcol_8_118274(OBJ)
     => tptpcol_7_117762(OBJ) ) )).

% Cyc Assertion #1299820:
fof(ax3_2296,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_sitreport_seeking_information_war_on_terrorism),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #1257995:
fof(ax3_2297,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0375726721vglance)),c_translation_31),c_basekb) )).

% Cyc Assertion #860435:
fof(ax3_2298,axiom,(
    genls(c_listtemplate,c_individual) )).

fof(ax3_2299,axiom,(
    ! [OBJ] :
      ( listtemplate(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1409290:
fof(ax3_2300,axiom,(
    genls(c_wetqfeverwetcoxiellaburnetii,c_partiallytangible) )).

fof(ax3_2301,axiom,(
    ! [OBJ] :
      ( wetqfeverwetcoxiellaburnetii(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #670961:
fof(ax3_2302,axiom,(
    arg2isa(c_setbehaviorcapable,c_setorcollection) )).

fof(ax3_2303,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( setbehaviorcapable(ARG1,ARG2,ARG3)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #194871:
fof(ax3_2304,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_32),c_basekb) )).

% Cyc Assertion #1381461:
fof(ax3_2305,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreenselectcoukvisitoreditorial562html)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #918404:
fof(ax3_2306,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom200508on_writinghtml)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #2178498:
fof(ax3_2307,axiom,(
    genlmt(c_tptp_member1891_mt,c_basekb) )).

% Cyc Assertion #1614361:
fof(ax3_2308,axiom,(
    genlmt(f_cblscriptexecutioncontextfn(s_topnode),c_basekb) )).

% Cyc Assertion #975891:
fof(ax3_2309,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwharrynilssoninfoindexphppagesearchsubactionsearchexpandnilssonpagesdetailpeter20lawford)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #735194:
fof(ax3_2310,axiom,(
    genlmt(f_contentmtfn(c_sxsw2003_ks),c_basekb) )).

% Cyc Assertion #1540362:
fof(ax3_2311,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2184554:
fof(ax3_2312,axiom,(
    genlmt(c_tptp_member3405_mt,c_basekb) )).

% Cyc Assertion #442647:
fof(ax3_2313,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwentropiaforumcomforumshistorytopic2216_1html)),c_translation_0),c_basekb) )).

% Cyc Assertion #1440487:
fof(ax3_2314,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwxcapewithuscomhot_dealshotels_in_city_of_andorra_la_vellahotel_floridaasp)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #293646:
fof(ax3_2315,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2178478:
fof(ax3_2316,axiom,(
    genlmt(c_tptp_member1886_mt,c_basekb) )).

% Cyc Assertion #1227014:
fof(ax3_2317,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwneverarycomn1n1umbrellahtm)),c_translation_12),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1193913:
fof(ax3_2318,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwphoenixnewtimescomissues2005_12_22cultureart2html)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1294777:
fof(ax3_2319,axiom,(
    genls(c_nondangeroustangiblething,c_partiallytangible) )).

fof(ax3_2320,axiom,(
    ! [OBJ] :
      ( nondangeroustangiblething(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1756980:
fof(ax3_2321,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #626077:
fof(ax3_2322,axiom,(
    genlmt(c_usgovernmentorganizationdatamt,c_basekb) )).

% Cyc Assertion #2181374:
fof(ax3_2323,axiom,(
    genlmt(c_tptp_member2610_mt,c_basekb) )).

% Cyc Assertion #2178282:
fof(ax3_2324,axiom,(
    genlmt(c_tptp_member1837_mt,c_basekb) )).

% Cyc Assertion #2481997:
fof(ax3_2325,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x50_y7) )).

% Cyc Assertion #192388:
fof(ax3_2326,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_blogouter_courtcomegobrowsertim_allenhtml)),c_translation_24),c_basekb) )).

% Cyc Assertion #487992:
fof(ax3_2327,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #2177119:
fof(ax3_2328,axiom,(
    genlmt(c_tptp_member1546_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #2286118:
fof(ax3_2329,axiom,(
    individual(c_tptpsphere_5) )).

% Cyc Assertion #299685:
fof(ax3_2330,axiom,(
    arg2isa(c_odorthreshold,c_concentrationstrength) )).

fof(ax3_2331,axiom,(
    ! [ARG1,ARG2] :
      ( odorthreshold(ARG1,ARG2)
     => concentrationstrength(ARG2) ) )).

% Cyc Assertion #499377:
fof(ax3_2332,axiom,(
    genlmt(c_middleearthmt,c_calendarsmt) )).

% Cyc Assertion #1004971:
fof(ax3_2333,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_research,c_objectofinvestigation,f_subcollectionofwithrelationtotypefn(c_manufacturing,c_productscreated,c_nuclearweapon)))
     => individual(OBJ) ) )).

fof(ax3_2334,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_research,c_objectofinvestigation,f_subcollectionofwithrelationtotypefn(c_manufacturing,c_productscreated,c_nuclearweapon)),c_individual) )).

fof(ax3_2335,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnresearchobjectofinvestigationsubcollectionofwithrelationtotypefnmanufacturingproductscreatednuclearweapon(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #478534:
fof(ax3_2336,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_powerofchristnetcgi_binapf4amazon_products_feedcgioperationitemlookupitemidb00003cxae)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1064669:
fof(ax3_2337,axiom,(
    genls(c_slam_cruisemissile,c_individual) )).

fof(ax3_2338,axiom,(
    ! [OBJ] :
      ( slam_cruisemissile(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #225959:
fof(ax3_2339,axiom,(
    genlmt(c_animalmovementmt,c_basekb) )).

% Cyc Assertion #1365342:
fof(ax3_2340,axiom,(
    genlmt(c_guystestmt,c_basekb) )).

% Cyc Assertion #2184390:
fof(ax3_2341,axiom,(
    genlmt(c_tptp_member3364_mt,c_basekb) )).

% Cyc Assertion #1342780:
fof(ax3_2342,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtkborggroupjspgroupid61)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #513922:
fof(ax3_2343,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcinemareviewcomcastcrewaspid822)),c_translation_28),c_basekb) )).

% Cyc Assertion #304832:
fof(ax3_2344,axiom,(
    genlmt(c_serviceorginternalsmt,c_basekb) )).

% Cyc Assertion #2184314:
fof(ax3_2345,axiom,(
    genlmt(c_tptp_member3345_mt,c_basekb) )).

% Cyc Assertion #353724:
fof(ax3_2346,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcinemareviewcomcastcrewaspid822)),c_translation_32),c_basekb) )).

% Cyc Assertion #1139992:
fof(ax3_2347,axiom,(
    genls(c_jobpositionbyopeningstatus,c_collection) )).

fof(ax3_2348,axiom,(
    ! [OBJ] :
      ( jobpositionbyopeningstatus(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #266479:
fof(ax3_2349,axiom,(
    genlmt(c_patternsofglobalterrorism2000mt,c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #500874:
fof(ax3_2350,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentfilm4009157stm)),c_translation_30),c_basekb) )).

% Cyc Assertion #502181:
fof(ax3_2351,axiom,(
    individual(f_urlreferentfn(f_urlfn(f_urlfn(s_http_wwwgerardbutlernethavenindexphps4e1eb232cb7f9542a7a735fdf80e0e75showtopic23076st10)))) )).

% Cyc Assertion #1592748:
fof(ax3_2352,axiom,(
    genlmt(c_missilemastertablemt,c_basekb) )).

% Cyc Assertion #1079510:
fof(ax3_2353,axiom,(
    genls(c_logcrib,c_individual) )).

fof(ax3_2354,axiom,(
    ! [OBJ] :
      ( logcrib(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1442804:
fof(ax3_2355,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsurfnetinccomchuckjwaynehtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #437021:
fof(ax3_2356,axiom,(
    genls(c_umlstatemachinecontextframe,c_microtheory) )).

fof(ax3_2357,axiom,(
    ! [OBJ] :
      ( umlstatemachinecontextframe(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #241563:
fof(ax3_2358,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsdvdfilecomshowthreadphpt16217)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1307471:
fof(ax3_2359,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1532905:
fof(ax3_2360,axiom,(
    genlmt(c_geographicalregiongvocabularymt,c_basekb) )).

% Cyc Assertion #563611:
fof(ax3_2361,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcrimelibrarycomterrorists_spiesterroristselsayid_nosair8htmlsect7)),c_translation_2),c_basekb) )).

% Cyc Assertion #1757575:
fof(ax3_2362,axiom,(
    genlmt(f_contextofpcwfn(c_ap_martha_stewart_omnimedia_names_chairman),c_massmediadatamt) )).

% Cyc Assertion #798433:
fof(ax3_2363,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_reviewsauthorstorecom200504an_anonymous_auhtml)),c_translation_15),c_basekb) )).

% Cyc Assertion #1511308:
fof(ax3_2364,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlanguage_schools_directorycomcityphp3titlewalescountry118languagegb)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #629541:
fof(ax3_2365,axiom,(
    genls(c_perfectivevbartemplate,c_individual) )).

fof(ax3_2366,axiom,(
    ! [OBJ] :
      ( perfectivevbartemplate(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #265917:
fof(ax3_2367,axiom,(
    individual(f_computervulnerabilityreportfn(c_certadvisorydatabase,s_ca_2002_27)) )).

% Cyc Assertion #1678527:
fof(ax3_2368,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_stufffn(c_loin_meatcut))
     => partiallytangible(OBJ) ) )).

fof(ax3_2369,axiom,(
    genls(f_stufffn(c_loin_meatcut),c_partiallytangible) )).

fof(ax3_2370,axiom,(
    ! [OBJ] :
      ( stufffnloin_meatcut(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #611510:
fof(ax3_2371,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_legendstypepadcomliving_with_legends_the_h200507cult_fictionhtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1153565:
fof(ax3_2372,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182217:
fof(ax3_2373,axiom,(
    microtheory(c_tptp_member2821_mt) )).

% Cyc Assertion #1377466:
fof(ax3_2374,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_16),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1698775:
fof(ax3_2375,axiom,(
    genls(c_airforcepersonnel,c_militaryperson) )).

fof(ax3_2376,axiom,(
    ! [OBJ] :
      ( airforcepersonnel(OBJ)
     => militaryperson(OBJ) ) )).

% Cyc Assertion #2173434:
fof(ax3_2377,axiom,(
    genlmt(c_tptp_member625_mt,c_basekb) )).

% Cyc Assertion #2180442:
fof(ax3_2378,axiom,(
    genlmt(c_tptp_member2377_mt,c_basekb) )).

% Cyc Assertion #1366004:
fof(ax3_2379,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetmoderatebreezeareamostlycloudcoveredarea(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2181526:
fof(ax3_2380,axiom,(
    genlmt(c_tptp_member2648_mt,c_basekb) )).

% Cyc Assertion #1873956:
fof(ax3_2381,axiom,(
    genls(c_tptpcol_5_20483,c_tptpcol_4_16387) )).

fof(ax3_2382,axiom,(
    ! [OBJ] :
      ( tptpcol_5_20483(OBJ)
     => tptpcol_4_16387(OBJ) ) )).

% Cyc Assertion #1695346:
fof(ax3_2383,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsshopeasiercomfilesshopeasier_kathleen_kennedyhtml)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1181611:
fof(ax3_2384,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_8),c_basekb) )).

% Cyc Assertion #1573834:
fof(ax3_2385,axiom,
    ( mtvisible(c_militarygvocabularymt)
   => genls(c_triethylphosphate,c_partiallytangible) )).

fof(ax3_2386,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygvocabularymt)
        & triethylphosphate(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1449987:
fof(ax3_2387,axiom,(
    genls(c_conceptfilterparametertype_trigger,c_individual) )).

fof(ax3_2388,axiom,(
    ! [OBJ] :
      ( conceptfilterparametertype_trigger(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1793035:
fof(ax3_2389,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_rustypetermanblogspotcom2005_01_01_rustypeterman_archivehtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #307337:
fof(ax3_2390,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_32),c_basekb) )).

% Cyc Assertion #1029121:
fof(ax3_2391,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_2167415071ski_europeskimatchermap_contentpageaspitem_id55)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #405921:
fof(ax3_2392,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwepinionscomcontent_106804514436)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #848758:
fof(ax3_2393,axiom,(
    transitivebinarypredicate(c_eventdisables) )).

% Cyc Assertion #1639373:
fof(ax3_2394,axiom,
    ( mtvisible(c_englishmt)
   => prettystring(f_subcollectionofwithrelationfromtypefn(c_terrorist,c_hasmembers,c_terroristgroup),s_terroristthathasbeenamemberofagroup) )).

% Cyc Assertion #778055:
fof(ax3_2395,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwintrepidmediacomcolumnaspid1995)),c_translation_2),c_basekb) )).

% Cyc Assertion #1770268:
fof(ax3_2396,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplecchristiedougftppypeoplecchristiedougcanadaright)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1710415:
fof(ax3_2397,axiom,(
    genls(c_savorytaste,c_partiallytangible) )).

fof(ax3_2398,axiom,(
    ! [OBJ] :
      ( savorytaste(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1233607:
fof(ax3_2399,axiom,(
    genlmt(c_us_centralcommandhomepage,c_basekb) )).

% Cyc Assertion #2186014:
fof(ax3_2400,axiom,(
    genlmt(c_tptp_member3770_mt,c_basekb) )).

% Cyc Assertion #1086801:
fof(ax3_2401,axiom,(
    genls(c_cycinternaltask_39,c_individual) )).

fof(ax3_2402,axiom,(
    ! [OBJ] :
      ( cycinternaltask_39(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1591370:
fof(ax3_2403,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwulfgarfreeserverscommovie20reviews20archivehtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185803:
fof(ax3_2404,axiom,(
    genlmt(c_tptp_member3717_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1784265:
fof(ax3_2405,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfairisaaccomfairisaacsolutionsenterprisedecisionmanagementbusinessrulesblazeadvisorblazeadvisorpartnerdirectoryhtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1661008:
fof(ax3_2406,axiom,(
    unitofmeasureconcept(c_dispositionalquantity) )).

% Cyc Assertion #2173962:
fof(ax3_2407,axiom,(
    genlmt(c_tptp_member757_mt,c_basekb) )).

% Cyc Assertion #1277762:
fof(ax3_2408,axiom,(
    genlmt(c_olympicsmt,c_basekb) )).

% Cyc Assertion #627572:
fof(ax3_2409,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwanabaptistsorgbooksmdrjustifyhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1372128:
fof(ax3_2410,axiom,(
    genlmt(c_knowledgefragmentk2mt,c_basekb) )).

% Cyc Assertion #1772753:
fof(ax3_2411,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom2005_07_01_cycledog_archivehtml)),c_translation_28),c_basekb) )).

% Cyc Assertion #698374:
fof(ax3_2412,axiom,(
    genlmt(c_femalehumanbodystructuremt,c_basekb) )).

% Cyc Assertion #962307:
fof(ax3_2413,axiom,(
    individual(c_balaghat_district_india) )).

% Cyc Assertion #1021431:
fof(ax3_2414,axiom,(
    genlmt(c_englishtemplatemt,c_basekb) )).

% Cyc Assertion #2171070:
fof(ax3_2415,axiom,(
    genlmt(c_tptp_member34_mt,c_basekb) )).

% Cyc Assertion #778037:
fof(ax3_2416,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwheritagepreservationorghhicase276html)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2335456:
fof(ax3_2417,axiom,(
    executionbyfiringsquad(c_tptpexecutionbyfiringsquad_811) )).

% Cyc Assertion #1214602:
fof(ax3_2418,axiom,(
    existingobjecttype(f_jointtypebetweenfn(c_ethmoid,f_leftobjectofpairfn(c_lacrimalbone))) )).

% Cyc Assertion #2175582:
fof(ax3_2419,axiom,(
    genlmt(c_tptp_member1162_mt,c_basekb) )).

% Cyc Assertion #1217579:
fof(ax3_2420,axiom,(
    genls(c_glfgraphcomponent,c_partiallyintangibleindividual) )).

fof(ax3_2421,axiom,(
    ! [OBJ] :
      ( glfgraphcomponent(OBJ)
     => partiallyintangibleindividual(OBJ) ) )).

% Cyc Assertion #1986593:
fof(ax3_2422,axiom,(
    genls(c_tptpcol_2_65537,c_tptpcol_1_65536) )).

fof(ax3_2423,axiom,(
    ! [OBJ] :
      ( tptpcol_2_65537(OBJ)
     => tptpcol_1_65536(OBJ) ) )).

% Cyc Assertion #2172438:
fof(ax3_2424,axiom,(
    genlmt(c_tptp_member376_mt,c_basekb) )).

% Cyc Assertion #680322:
fof(ax3_2425,axiom,(
    genlmt(f_contextofpcwfn(c_hezbollahintelreport),c_basekb) )).

% Cyc Assertion #2482847:
fof(ax3_2426,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x60_y47) )).

% Cyc Assertion #1312138:
fof(ax3_2427,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordcageoffset0)),c_translation_31),c_basekb) )).

% Cyc Assertion #525995:
fof(ax3_2428,axiom,(
    genlmt(c_firemenandfiretruckimt,c_basekb) )).

% Cyc Assertion #2186334:
fof(ax3_2429,axiom,(
    genlmt(c_tptp_member3850_mt,c_basekb) )).

% Cyc Assertion #2181910:
fof(ax3_2430,axiom,(
    genlmt(c_tptp_member2744_mt,c_basekb) )).

% Cyc Assertion #1508848:
fof(ax3_2431,axiom,(
    genls(c_refugeecamp,c_geographicalregion) )).

fof(ax3_2432,axiom,(
    ! [OBJ] :
      ( refugeecamp(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1141094:
fof(ax3_2433,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_crestcommtfilebankdocumentsport_mmdpdf)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #139316:
fof(ax3_2434,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcbccainsitethe_sunday_edition2004118html)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #169806:
fof(ax3_2435,axiom,(
    genlmt(c_culturegmt,c_basekb) )).

% Cyc Assertion #1507032:
fof(ax3_2436,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1073941:
fof(ax3_2437,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineseatscomwill_smith_ticketsindexasp)),c_translation_34_5),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1141656:
fof(ax3_2438,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_shakespeareauthorshipcomox12html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183874:
fof(ax3_2439,axiom,(
    genlmt(c_tptp_member3235_mt,c_basekb) )).

% Cyc Assertion #2180766:
fof(ax3_2440,axiom,(
    genlmt(c_tptp_member2458_mt,c_basekb) )).

% Cyc Assertion #1007660:
fof(ax3_2441,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviepoopshootcomnewsaug027html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #741117:
fof(ax3_2442,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwenduringwordcomcommentaries2701htm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1449552:
fof(ax3_2443,axiom,(
    genls(c_geoculturalregion,c_geographicalregion) )).

fof(ax3_2444,axiom,(
    ! [OBJ] :
      ( geoculturalregion(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1249922:
fof(ax3_2445,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwphoenixnewtimescomissues2005_12_22cultureart2html)),c_translation_29),c_basekb) )).

% Cyc Assertion #2172146:
fof(ax3_2446,axiom,(
    genlmt(c_tptp_member303_mt,c_basekb) )).

% Cyc Assertion #409618:
fof(ax3_2447,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dailyblabberivillagecomentertainmentarchives200511desperate_house_1html)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1545861:
fof(ax3_2448,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_11),c_basekb) )).

% Cyc Assertion #273056:
fof(ax3_2449,axiom,(
    genlmt(f_culturedefinitioncollectormtfn(f_nationalculturefn(c_kuwait)),c_basekb) )).

% Cyc Assertion #818815:
fof(ax3_2450,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_dossier_lt_gen_mustafa_tlass),c_basekb) )).

% Cyc Assertion #623458:
fof(ax3_2451,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_rogerlsimoncomarchives00000753htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #1021365:
fof(ax3_2452,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2286802:
fof(ax3_2453,axiom,(
    genlmt(c_tptpnlexiconextensionhypothesismttypeforlanguagefnenglishlanguage,c_basekb) )).

% Cyc Assertion #282166:
fof(ax3_2454,axiom,
    ( mtvisible(c_cycnounlearnermt)
   => genls(c_subtitle,c_aspatialinformationstore) )).

fof(ax3_2455,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_cycnounlearnermt)
        & subtitle(OBJ) )
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #2185990:
fof(ax3_2456,axiom,(
    genlmt(c_tptp_member3764_mt,c_basekb) )).

% Cyc Assertion #394966:
fof(ax3_2457,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_26),c_basekb) )).

% Cyc Assertion #1224975:
fof(ax3_2458,axiom,(
    genlmt(c_basichumanrights_undeclaration,c_basekb) )).

% Cyc Assertion #162759:
fof(ax3_2459,axiom,(
    genls(c_sksiprofilingquery_multisource,c_individual) )).

fof(ax3_2460,axiom,(
    ! [OBJ] :
      ( sksiprofilingquery_multisource(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #404853:
fof(ax3_2461,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesettitlehumannamestringhumannamesuffixhumangivennamehumansurname(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2332981:
fof(ax3_2462,axiom,(
    genlmt(c_tptpnlexiconextensionhypothesismttypeforlanguagefnamericanenglishdialect_3,c_basekb) )).

% Cyc Assertion #1582563:
fof(ax3_2463,axiom,(
    genlmt(f_modelmtbyuserandtaskfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),f_glassboxallotmentfn(s_9c416432_b89a_4a1c_8796_12ce4f0f1626)),c_basekb) )).

% Cyc Assertion #1639672:
fof(ax3_2464,axiom,(
    genlmt(c_charliecriterion4_infoconcriterionmt,c_basekb) )).

% Cyc Assertion #755926:
fof(ax3_2465,axiom,(
    genlmt(c_pq125mt,c_basekb) )).

% Cyc Assertion #1397628:
fof(ax3_2466,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_homepagesihugconzghawkinsimqsbreshtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #861497:
fof(ax3_2467,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_ukencartamsncomencyclopedia_761573010_4united_states_of_americahtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175730:
fof(ax3_2468,axiom,(
    genlmt(c_tptp_member1199_mt,c_basekb) )).

% Cyc Assertion #316898:
fof(ax3_2469,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_familyscreensceneallinfoaboutcomtvone_tree_hillhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #136110:
fof(ax3_2470,axiom,(
    genlmt(c_wordnetindividualmappingmt,c_basekb) )).

% Cyc Assertion #2180823:
fof(ax3_2471,axiom,(
    genlmt(c_tptp_member2472_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1133891:
fof(ax3_2472,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_abcnetaunewenglandmornings)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2352862:
fof(ax3_2473,axiom,(
    individual(c_tptpridgeline_topographical) )).

% Cyc Assertion #663772:
fof(ax3_2474,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstartrekcomstartrekviewnewsarticle124354html)),c_translation_30),c_basekb) )).

% Cyc Assertion #1604706:
fof(ax3_2475,axiom,(
    genlmt(c_inferencepsc,c_basekb) )).

% Cyc Assertion #1366777:
fof(ax3_2476,axiom,(
    genlmt(c_retailbuyingmt,c_basekb) )).

% Cyc Assertion #1363736:
fof(ax3_2477,axiom,(
    geographicalthing(c_thesprotia_departmentgreece) )).

% Cyc Assertion #208313:
fof(ax3_2478,axiom,(
    genlmt(f_structureofclassificationsystemmtfn(c_lscomobjectandsituationontology),c_basekb) )).

% Cyc Assertion #2269340:
fof(ax3_2479,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_792) )).

% Cyc Assertion #1477864:
fof(ax3_2480,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive200409)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #156619:
fof(ax3_2481,axiom,(
    genlmt(f_contentmtfn(c_butlerinferencestore_ks),c_basekb) )).

% Cyc Assertion #1058371:
fof(ax3_2482,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmastercarsdirectcoukcar_hireusa_sacramentohtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #968079:
fof(ax3_2483,axiom,(
    genls(c_attemptingmurderdeviceusedaxe,c_individual) )).

fof(ax3_2484,axiom,(
    ! [OBJ] :
      ( attemptingmurderdeviceusedaxe(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1003341:
fof(ax3_2485,axiom,(
    genlmt(c_mainstreamaustralasianculturemt,c_basekb) )).

% Cyc Assertion #948120:
fof(ax3_2486,axiom,(
    transitivebinarypredicate(c_compositeparts) )).

% Cyc Assertion #1338663:
fof(ax3_2487,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwobeluscom)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #836890:
fof(ax3_2488,axiom,(
    genlmt(f_contextofpcwfn(c_foodanddrinktaxonomy),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #477807:
fof(ax3_2489,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetunarypredicatecommonmodaloperator(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2189800:
fof(ax3_2490,axiom,(
    ! [TERM] :
      ( isa(TERM,f_subcollectionofwithrelationtotypefn(c_issuingaprescription,c_products,c_correctivelensprescription))
     => tptp_8_968(f_relationexistsallfn(TERM,c_tptp_8_968,c_tptpcol_14_7210,f_subcollectionofwithrelationtotypefn(c_issuingaprescription,c_products,c_correctivelensprescription)),TERM) ) )).

fof(ax3_2491,axiom,(
    relationexistsall(c_tptp_8_968,c_tptpcol_14_7210,f_subcollectionofwithrelationtotypefn(c_issuingaprescription,c_products,c_correctivelensprescription)) )).

% Cyc Assertion #234485:
fof(ax3_2492,axiom,(
    genlmt(c_russianmafiatestcasemt,c_basekb) )).

% Cyc Assertion #235525:
fof(ax3_2493,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadiannorthern_foundationcanadaright)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #458750:
fof(ax3_2494,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjerrylentzcomarchive2003_06_01_archivehtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #602848:
fof(ax3_2495,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecoukforumtmaspm62284mpage2)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #797639:
fof(ax3_2496,axiom,(
    genlmt(c_oainstance2mt,c_basekb) )).

% Cyc Assertion #2482982:
fof(ax3_2497,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x62_y20) )).

% Cyc Assertion #623630:
fof(ax3_2498,axiom,(
    genls(c_cycloperator,c_individual) )).

fof(ax3_2499,axiom,(
    ! [OBJ] :
      ( cycloperator(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #953443:
fof(ax3_2500,axiom,(
    genlmt(c_cyclificationcollectormt_peterwagnerownsadog,c_basekb) )).

% Cyc Assertion #998316:
fof(ax3_2501,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtfhtm)),c_translation_31),c_basekb) )).

% Cyc Assertion #2177298:
fof(ax3_2502,axiom,(
    genlmt(c_tptp_member1591_mt,c_basekb) )).

% Cyc Assertion #688038:
fof(ax3_2503,axiom,(
    genls(c_rough,c_partiallytangible) )).

fof(ax3_2504,axiom,(
    ! [OBJ] :
      ( rough(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #825452:
fof(ax3_2505,axiom,(
    arg2isa(c_semtranstemplatefn,c_collection) )).

% Cyc Assertion #968647:
fof(ax3_2506,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_artsedgekennedy_centerorgcontent3498)),c_translation_11),c_basekb) )).

% Cyc Assertion #2118034:
fof(ax3_2507,axiom,(
    genls(c_tptpcol_13_118117,c_tptpcol_12_118116) )).

fof(ax3_2508,axiom,(
    ! [OBJ] :
      ( tptpcol_13_118117(OBJ)
     => tptpcol_12_118116(OBJ) ) )).

% Cyc Assertion #1379806:
fof(ax3_2509,axiom,(
    genlmt(c_pq253mt,c_basekb) )).

% Cyc Assertion #2343486:
fof(ax3_2510,axiom,
    ( mtvisible(c_tptp_member947_mt)
   => isa(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_3420,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )).

fof(ax3_2511,axiom,
    ( mtvisible(c_tptp_member947_mt)
   => subcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_3420) )).

% Cyc Assertion #1327997:
fof(ax3_2512,axiom,(
    genlmt(c_pq228mt,c_testvocabularymt) )).

% Cyc Assertion #1559403:
fof(ax3_2513,axiom,(
    genls(c_thetextlearnerprocedureforevaluatingcontenthypothesismicrotheory,c_individual) )).

fof(ax3_2514,axiom,(
    ! [OBJ] :
      ( thetextlearnerprocedureforevaluatingcontenthypothesismicrotheory(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #237927:
fof(ax3_2515,axiom,(
    genlmt(c_productgmt,c_basekb) )).

% Cyc Assertion #1274621:
fof(ax3_2516,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfwsgovendangerediasaa8dhtml)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2027554:
fof(ax3_2517,axiom,(
    genls(c_tptpcol_4_81922,c_tptpcol_3_81921) )).

fof(ax3_2518,axiom,(
    ! [OBJ] :
      ( tptpcol_4_81922(OBJ)
     => tptpcol_3_81921(OBJ) ) )).

% Cyc Assertion #852108:
fof(ax3_2519,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cbinicintjun02htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1509989:
fof(ax3_2520,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_mobfn(c_fettucininoodle))
     => partiallytangible(OBJ) ) )).

fof(ax3_2521,axiom,(
    genls(f_mobfn(c_fettucininoodle),c_partiallytangible) )).

fof(ax3_2522,axiom,(
    ! [OBJ] :
      ( mobfnfettucininoodle(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2174966:
fof(ax3_2523,axiom,(
    genlmt(c_tptp_member1008_mt,c_basekb) )).

% Cyc Assertion #211653:
fof(ax3_2524,axiom,(
    genlmt(c_y1phase2_stage1mt,c_basekb) )).

% Cyc Assertion #2182938:
fof(ax3_2525,axiom,(
    genlmt(c_tptp_member3001_mt,c_basekb) )).

% Cyc Assertion #762534:
fof(ax3_2526,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetalternateroutefreeway(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #486076:
fof(ax3_2527,axiom,(
    genls(c_thesaurus_represented,c_microtheory) )).

fof(ax3_2528,axiom,(
    ! [OBJ] :
      ( thesaurus_represented(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #2185506:
fof(ax3_2529,axiom,(
    genlmt(c_tptp_member3643_mt,c_basekb) )).

% Cyc Assertion #404798:
fof(ax3_2530,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpsychiatristcompccpccpdfv06s02v06s0203pdf)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #232208:
fof(ax3_2531,axiom,(
    genls(c_newbabyflowerarrangement,c_artifact) )).

fof(ax3_2532,axiom,(
    ! [OBJ] :
      ( newbabyflowerarrangement(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1413148:
fof(ax3_2533,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_freepagesgenealogyrootswebcomehowetimeline1820html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1770180:
fof(ax3_2534,axiom,(
    physicalorderingpredicate(c_spatiallycontains) )).

% Cyc Assertion #1672355:
fof(ax3_2535,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_21),c_basekb) )).

% Cyc Assertion #2178118:
fof(ax3_2536,axiom,(
    genlmt(c_tptp_member1796_mt,c_basekb) )).

% Cyc Assertion #1416361:
fof(ax3_2537,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_intelligentagent,c_hasleaders,c_politicalparty))
     => individual(OBJ) ) )).

fof(ax3_2538,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_intelligentagent,c_hasleaders,c_politicalparty),c_individual) )).

fof(ax3_2539,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnintelligentagenthasleaderspoliticalparty(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1290856:
fof(ax3_2540,axiom,(
    genlmt(c_attribute_collectionconversionmt,c_basekb) )).

% Cyc Assertion #2184026:
fof(ax3_2541,axiom,(
    genlmt(c_tptp_member3273_mt,c_basekb) )).

% Cyc Assertion #312219:
fof(ax3_2542,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_groupsmsncomthespiritdetectivesayuyuhakushorpgsarayashikihighmsnwactionget_messagemview0id_message17012lastmodified4675527165630904879)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #698605:
fof(ax3_2543,axiom,(
    genlmt(f_contextofpcwfn(c_2001_aspaceodyssey_themovie),c_basekb) )).

% Cyc Assertion #809141:
fof(ax3_2544,axiom,(
    genls(c_usmilitaryservicepersonnel,c_militaryperson) )).

fof(ax3_2545,axiom,(
    ! [OBJ] :
      ( usmilitaryservicepersonnel(OBJ)
     => militaryperson(OBJ) ) )).

% Cyc Assertion #529313:
fof(ax3_2546,axiom,(
    genlmt(c_rkfobstaclesap_scriptmt,c_basekb) )).

% Cyc Assertion #2176354:
fof(ax3_2547,axiom,(
    genlmt(c_tptp_member1355_mt,c_basekb) )).

% Cyc Assertion #2179322:
fof(ax3_2548,axiom,(
    genlmt(c_tptp_member2097_mt,c_basekb) )).

% Cyc Assertion #184833:
fof(ax3_2549,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstudentsoftheworldinfositesmisc1403php)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #505858:
fof(ax3_2550,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetclearweatherareamoderatebreezearea(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #757058:
fof(ax3_2551,axiom,(
    individual(f_citynamedfn(s_iliamna,c_alaska_state)) )).

% Cyc Assertion #2394128:
fof(ax3_2552,axiom,(
    individual(c_tptpnsubcollectionofwithrelationtofnguntemperatureofobjectwarm_8) )).

% Cyc Assertion #1385507:
fof(ax3_2553,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & isa(OBJ,f_conjugateacidofbasefn(f_chemicalsubstancefn(c_bisulfateion))) )
     => partiallytangible(OBJ) ) )).

fof(ax3_2554,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(f_conjugateacidofbasefn(f_chemicalsubstancefn(c_bisulfateion)),c_partiallytangible) )).

fof(ax3_2555,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & conjugateacidofbasefnchemicalsubstancefnbisulfateion(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2182106:
fof(ax3_2556,axiom,(
    genlmt(c_tptp_member2793_mt,c_basekb) )).

% Cyc Assertion #228555:
fof(ax3_2557,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomresearchtrianglelab4191millermillershtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #369546:
fof(ax3_2558,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsearchgodswordorgcombccviewcgibookrochapter005)),c_translation_32),c_basekb) )).

% Cyc Assertion #2153241:
fof(ax3_2559,axiom,(
    genlinverse(c_tptptypes_9_401,c_tptptypes_8_400) )).

fof(ax3_2560,axiom,(
    ! [ARG1,ARG2] :
      ( tptptypes_9_401(ARG1,ARG2)
     => tptptypes_8_400(ARG2,ARG1) ) )).

% Cyc Assertion #228969:
fof(ax3_2561,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwiueduusersmfwcwiugreatgatsbyhtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #235469:
fof(ax3_2562,axiom,(
    genlmt(f_contentmtfn(c_fg1_feature_dms_lat_ks),c_basekb) )).

% Cyc Assertion #569534:
fof(ax3_2563,axiom,(
    arg2isa(c_siblingdisjointexceptions,c_setorcollection) )).

fof(ax3_2564,axiom,(
    ! [ARG1,ARG2] :
      ( siblingdisjointexceptions(ARG1,ARG2)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #1186692:
fof(ax3_2565,axiom,(
    genlmt(c_coabstestmt,c_testvocabularymt) )).

% Cyc Assertion #2175702:
fof(ax3_2566,axiom,(
    genlmt(c_tptp_member1192_mt,c_basekb) )).

% Cyc Assertion #914331:
fof(ax3_2567,axiom,(
    ! [OBJ] :
      ( collectionsubsetfncollectionintersection2fnirishpersonsoldierthesetofobjthereexistsxandgenlsxpeacekeepingforcerelationallinstanceaffiliatedwithxunitednationsorganizationrelationinstanceexistswith_underspecifiedagentobjx(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #288576:
fof(ax3_2568,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcommongroundcommonsenseorgforumsindexphpshowtopic10194)),c_translation_2),c_basekb) )).

% Cyc Assertion #448491:
fof(ax3_2569,axiom,
    ( mtvisible(c_ciaworldfactbook1997mt)
   => genls(c_pyrite,c_partiallytangible) )).

fof(ax3_2570,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_ciaworldfactbook1997mt)
        & pyrite(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2477697:
fof(ax3_2571,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x18_y0) )).

% Cyc Assertion #1556260:
fof(ax3_2572,axiom,(
    genlmt(c_unitedstatesnaturalgeographymt,c_basekb) )).

% Cyc Assertion #177689:
fof(ax3_2573,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc33477)),c_translation_14),c_basekb) )).

% Cyc Assertion #1782646:
fof(ax3_2574,axiom,(
    genlmt(c_scenariogenerationtestdatamt,c_basekb) )).

% Cyc Assertion #2185456:
fof(ax3_2575,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member3630_mt) )).

% Cyc Assertion #350149:
fof(ax3_2576,axiom,(
    genls(c_insalignmentpad,c_partiallytangible) )).

fof(ax3_2577,axiom,(
    ! [OBJ] :
      ( insalignmentpad(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #144350:
fof(ax3_2578,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archnetorglibrarysitesone_sitetclsite_id3225)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183762:
fof(ax3_2579,axiom,(
    genlmt(c_tptp_member3207_mt,c_basekb) )).

% Cyc Assertion #1075106:
fof(ax3_2580,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #725022:
fof(ax3_2581,axiom,(
    genls(c_springflowerarrangement,c_artifact) )).

fof(ax3_2582,axiom,(
    ! [OBJ] :
      ( springflowerarrangement(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1645436:
fof(ax3_2583,axiom,
    ( mtvisible(c_hpkbvocabmt)
   => arg2isa(c_setbehaviorcapable,c_setorcollection) )).

fof(ax3_2584,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( ( mtvisible(c_hpkbvocabmt)
        & setbehaviorcapable(ARG1,ARG2,ARG3) )
     => setorcollection(ARG2) ) )).

% Cyc Assertion #1594395:
fof(ax3_2585,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive200409)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184398:
fof(ax3_2586,axiom,(
    genlmt(c_tptp_member3366_mt,c_basekb) )).

% Cyc Assertion #587350:
fof(ax3_2587,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_database_cia_world_factbook_2005),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #2180914:
fof(ax3_2588,axiom,(
    genlmt(c_tptp_member2495_mt,c_basekb) )).

% Cyc Assertion #981787:
fof(ax3_2589,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2177630:
fof(ax3_2590,axiom,(
    genlmt(c_tptp_member1674_mt,c_basekb) )).

% Cyc Assertion #802771:
fof(ax3_2591,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_freerepubliccomfocuskeywordkgenerationy)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #842762:
fof(ax3_2592,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_freerepubliccomfocuskeywordkgenerationy)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #338434:
fof(ax3_2593,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_21),c_basekb) )).

% Cyc Assertion #2180894:
fof(ax3_2594,axiom,(
    genlmt(c_tptp_member2490_mt,c_basekb) )).

% Cyc Assertion #2182522:
fof(ax3_2595,axiom,(
    genlmt(c_tptp_member2897_mt,c_basekb) )).

% Cyc Assertion #2178306:
fof(ax3_2596,axiom,(
    genlmt(c_tptp_member1843_mt,c_basekb) )).

% Cyc Assertion #1773903:
fof(ax3_2597,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwanswerscomtopicmeir_kahane)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1093653:
fof(ax3_2598,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnonfictionspotscomsitepagepress_articleid114)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1791219:
fof(ax3_2599,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_18),c_basekb) )).

% Cyc Assertion #144416:
fof(ax3_2600,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwyouthvoteorgnewsnewsdetailcfmnewsid544)),c_translation_0),c_basekb) )).

% Cyc Assertion #2177830:
fof(ax3_2601,axiom,(
    genlmt(c_tptp_member1724_mt,c_basekb) )).

% Cyc Assertion #485853:
fof(ax3_2602,axiom,(
    genlmt(f_contextofpcwfn(c_adultsshakehandseachtimetheygreet_custom),c_humansociallifemt) )).

% Cyc Assertion #2417029:
fof(ax3_2603,axiom,
    ( mtvisible(c_cyclistsmt)
   => nobelprizeforchemistrywinner(c_tptpnobelprizeforchemistrywinner_8) )).

% Cyc Assertion #2182674:
fof(ax3_2604,axiom,(
    genlmt(c_tptp_member2935_mt,c_basekb) )).

% Cyc Assertion #445108:
fof(ax3_2605,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediafabliscomindexphptechnical_university_of_munich)),c_translation_0),c_basekb) )).

% Cyc Assertion #220751:
fof(ax3_2606,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_attackawaterworksfacility,c_actiononobject,s_340faf91_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_2607,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_attackawaterworksfacility,c_actiononobject,s_340faf91_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_2608,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternaryattackawaterworksfacilityactiononobject340faf91_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2502810:
fof(ax3_2609,axiom,
    ( mtvisible(c_tptpgeo_member7_mt)
   => inregion(c_geolocation_x53_y74,c_georegion_l4_x53_y74) )).

% Cyc Assertion #638423:
fof(ax3_2610,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamericasdvdstorecomb00005uo7fsome_folks_call_it_a_sling_bladeshtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #314166:
fof(ax3_2611,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_priceseekeryo_storecompssling_bladepage_2)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1665917:
fof(ax3_2612,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwplaybillcomnewsarticle90099html)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1424353:
fof(ax3_2613,axiom,(
    genlmt(f_culturalscenariocontextfortaskfn(c_culturalscenarioevaluationallotment_01),c_basekb) )).

% Cyc Assertion #2176750:
fof(ax3_2614,axiom,(
    genlmt(c_tptp_member1454_mt,c_basekb) )).

% Cyc Assertion #1367636:
fof(ax3_2615,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_organization_ks),c_basekb) )).

% Cyc Assertion #881635:
fof(ax3_2616,axiom,(
    genls(c_ufo,c_partiallytangible) )).

fof(ax3_2617,axiom,(
    ! [OBJ] :
      ( ufo(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #726262:
fof(ax3_2618,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_b0000cbl7avglance)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1131101:
fof(ax3_2619,axiom,(
    genlmt(f_contentmtfn(c_fg1_name_language_ks),c_basekb) )).

% Cyc Assertion #571748:
fof(ax3_2620,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetunderwaterlocationgully(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #829106:
fof(ax3_2621,axiom,(
    genlmt(c_englishtypecoerciontheorymt,c_basekb) )).

% Cyc Assertion #170681:
fof(ax3_2622,axiom,(
    genlmt(f_contentmtfn(c_fg1_name_charset_ks),c_basekb) )).

% Cyc Assertion #1869481:
fof(ax3_2623,axiom,(
    genls(c_tptpcol_9_18694,c_tptpcol_8_18438) )).

fof(ax3_2624,axiom,(
    ! [OBJ] :
      ( tptpcol_9_18694(OBJ)
     => tptpcol_8_18438(OBJ) ) )).

% Cyc Assertion #1054055:
fof(ax3_2625,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikibruce_lee)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1597087:
fof(ax3_2626,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_mipt_tkb_group_profile__asbat_al_ansar),c_basekb) )).

% Cyc Assertion #565054:
fof(ax3_2627,axiom,(
    genlmt(c_bordersmt,c_basekb) )).

% Cyc Assertion #2095397:
fof(ax3_2628,axiom,(
    genls(c_tptpcol_10_109061,c_tptpcol_9_109060) )).

fof(ax3_2629,axiom,(
    ! [OBJ] :
      ( tptpcol_10_109061(OBJ)
     => tptpcol_9_109060(OBJ) ) )).

% Cyc Assertion #261078:
fof(ax3_2630,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetfoggyareamistyarealightthunderstormarea(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1297206:
fof(ax3_2631,axiom,(
    reflexivebinarypredicate(c_genlmt) )).

% Cyc Assertion #2173488:
fof(ax3_2632,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member638_mt) )).

% Cyc Assertion #858382:
fof(ax3_2633,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1123754:
fof(ax3_2634,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiplacesftppyplacescanadacanadaright)),c_translation_8),c_basekb) )).

% Cyc Assertion #498401:
fof(ax3_2635,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcrohnsnetmivaeducationcrohns_disease_faqsshtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #454308:
fof(ax3_2636,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcolumbusalivecom200020000406music1html)),c_translation_25),c_basekb) )).

% Cyc Assertion #1255845:
fof(ax3_2637,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrtcolcomoaklandbrockhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2307098:
fof(ax3_2638,axiom,(
    individual(c_tptptptpcol_16_73892_3) )).

% Cyc Assertion #1685497:
fof(ax3_2639,axiom,(
    genlmt(c_terrorismtacticsmt,c_basekb) )).

% Cyc Assertion #1479433:
fof(ax3_2640,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbluewaterwebcomnewsletterssept05_doyle2asp)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #443085:
fof(ax3_2641,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbasicstepsorgenglishnewtestamentstep10l7htm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #483545:
fof(ax3_2642,axiom,(
    genlmt(c_unitedstatesgeographyphysicalmt,c_basekb) )).

% Cyc Assertion #1328511:
fof(ax3_2643,axiom,(
    genlmt(c_housepainterimt,c_basekb) )).

% Cyc Assertion #1035744:
fof(ax3_2644,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviepoopshootcomnewsaug027html)),c_translation_2),c_basekb) )).

% Cyc Assertion #358144:
fof(ax3_2645,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtalkingbookworldcomfeaturedbook1aspstoreurltalkingbookworldbookid193105620x)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2171174:
fof(ax3_2646,axiom,(
    genlmt(c_tptp_member60_mt,c_basekb) )).

% Cyc Assertion #693298:
fof(ax3_2647,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_artsedgekennedy_centerorgcontent3498)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1354891:
fof(ax3_2648,axiom,
    ( mtvisible(c_modernmilitaryweaponsmt)
   => arg2isa(c_viablebasisforweapontype,c_collection) )).

fof(ax3_2649,axiom,(
    ! [ARG1,ARG2] :
      ( ( mtvisible(c_modernmilitaryweaponsmt)
        & viablebasisforweapontype(ARG1,ARG2) )
     => collection(ARG2) ) )).

% Cyc Assertion #1343353:
fof(ax3_2650,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgothamistcominterviewarchives20040929ben_lyons_mtv_cohostphp)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #594304:
fof(ax3_2651,axiom,(
    arg2isa(c_percentofterritoryis,c_collection) )).

fof(ax3_2652,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( percentofterritoryis(ARG1,ARG2,ARG3)
     => collection(ARG2) ) )).

% Cyc Assertion #2183702:
fof(ax3_2653,axiom,(
    genlmt(c_tptp_member3192_mt,c_basekb) )).

% Cyc Assertion #681595:
fof(ax3_2654,axiom,(
    reflexivebinarypredicate(c_mtalternatives) )).

% Cyc Assertion #2172402:
fof(ax3_2655,axiom,(
    genlmt(c_tptp_member367_mt,c_basekb) )).

% Cyc Assertion #541399:
fof(ax3_2656,axiom,(
    genlmt(c_temporarylexicalassertions_mattsmt,c_basekb) )).

% Cyc Assertion #2171578:
fof(ax3_2657,axiom,(
    genlmt(c_tptp_member161_mt,c_basekb) )).

% Cyc Assertion #1062459:
fof(ax3_2658,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_syria))
     => individual(OBJ) ) )).

fof(ax3_2659,axiom,(
    genls(f_residentfn(c_syria),c_individual) )).

fof(ax3_2660,axiom,(
    ! [OBJ] :
      ( residentfnsyria(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #768546:
fof(ax3_2661,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_tastefn(f_fruitfn(c_strawberryplant)))
     => partiallytangible(OBJ) ) )).

fof(ax3_2662,axiom,(
    genls(f_tastefn(f_fruitfn(c_strawberryplant)),c_partiallytangible) )).

fof(ax3_2663,axiom,(
    ! [OBJ] :
      ( tastefnfruitfnstrawberryplant(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #484698:
fof(ax3_2664,axiom,
    ( mtvisible(c_englishmt)
   => prettystring(f_urlfn(s_http_wwwictorgilinter_terorgattackcfmorgid13),s_http_wwwictorgilinter_terorgattackcfmorgid13) )).

% Cyc Assertion #2175786:
fof(ax3_2665,axiom,(
    genlmt(c_tptp_member1213_mt,c_basekb) )).

% Cyc Assertion #2177102:
fof(ax3_2666,axiom,(
    genlmt(c_tptp_member1542_mt,c_basekb) )).

% Cyc Assertion #256594:
fof(ax3_2667,axiom,(
    genlmt(c_glfgraphforsimplifiedinfectiousdiseaseapmt,c_testvocabularymt) )).

% Cyc Assertion #150858:
fof(ax3_2668,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwanswerscomtopicmeir_kahane)),c_translation_0),c_basekb) )).

% Cyc Assertion #1384139:
fof(ax3_2669,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_saltlake))
     => partiallytangible(OBJ) ) )).

fof(ax3_2670,axiom,(
    genls(f_groupfn(c_saltlake),c_partiallytangible) )).

fof(ax3_2671,axiom,(
    ! [OBJ] :
      ( groupfnsaltlake(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1063297:
fof(ax3_2672,axiom,
    ( mtvisible(c_unitedstatesgeographymt)
   => county(f_countynamedfn(s_wyoming,c_newyork_state)) )).

% Cyc Assertion #771814:
fof(ax3_2673,axiom,(
    genlmt(c_rkf_peterwagnerlivesintexascpcontentmt,c_basekb) )).

% Cyc Assertion #752572:
fof(ax3_2674,axiom,(
    genlmt(c_holidayexperimentalmt,c_basekb) )).

% Cyc Assertion #549363:
fof(ax3_2675,axiom,(
    genlmt(c_allenglishlexicalmicrotheorypsc,c_basekb) )).

% Cyc Assertion #369482:
fof(ax3_2676,axiom,(
    genls(c_dialupconnectiontoacomputernetwork,c_individual) )).

fof(ax3_2677,axiom,(
    ! [OBJ] :
      ( dialupconnectiontoacomputernetwork(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1383085:
fof(ax3_2678,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetonedimensionalthinglinearobject(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1400091:
fof(ax3_2679,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsundayheraldcom46696)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1006131:
fof(ax3_2680,axiom,(
    genlmt(c_salesmt,c_basekb) )).

% Cyc Assertion #2178047:
fof(ax3_2681,axiom,(
    genlmt(c_tptp_member1778_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1668817:
fof(ax3_2682,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_freethingoftypefn(c_internetservice))
     => individual(OBJ) ) )).

fof(ax3_2683,axiom,(
    genls(f_freethingoftypefn(c_internetservice),c_individual) )).

fof(ax3_2684,axiom,(
    ! [OBJ] :
      ( freethingoftypefninternetservice(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #446660:
fof(ax3_2685,axiom,(
    genlmt(c_patternsofglobalterrorism1995mt,c_basekb) )).

% Cyc Assertion #262293:
fof(ax3_2686,axiom,(
    genlmt(f_contextofpcwfn(c_jewishlawsystem),c_basekb) )).

% Cyc Assertion #298850:
fof(ax3_2687,axiom,(
    genls(c_pleatedconstruction,c_partiallytangible) )).

fof(ax3_2688,axiom,(
    ! [OBJ] :
      ( pleatedconstruction(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1168769:
fof(ax3_2689,axiom,(
    applicationcontext(c_rkfanalysisprocedurefwdrulesbackgroundmt) )).

% Cyc Assertion #1258227:
fof(ax3_2690,axiom,(
    genls(c_pathartifacttypebystructuralfeature,c_collection) )).

fof(ax3_2691,axiom,(
    ! [OBJ] :
      ( pathartifacttypebystructuralfeature(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1628579:
fof(ax3_2692,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_blogouter_courtcomegobrowsertim_allenhtml)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #240694:
fof(ax3_2693,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_chemicalobject))
     => partiallytangible(OBJ) ) )).

fof(ax3_2694,axiom,(
    genls(f_groupfn(c_chemicalobject),c_partiallytangible) )).

fof(ax3_2695,axiom,(
    ! [OBJ] :
      ( groupfnchemicalobject(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #341702:
fof(ax3_2696,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcbr_onlinecomcompanyprofileaspguidd80ec5c2_6048_4b8f_b693_8a87ad230a64)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #699410:
fof(ax3_2697,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_27),c_basekb) )).

% Cyc Assertion #1123092:
fof(ax3_2698,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwclubmomcomjforumpostslist75142052page)),c_translation_30),c_basekb) )).

% Cyc Assertion #2186578:
fof(ax3_2699,axiom,(
    genlmt(c_tptp_member3911_mt,c_basekb) )).

% Cyc Assertion #2362117:
fof(ax3_2700,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member2278_mt)
        & isa(INS,f_facilitytypeoforganizationtypefn(c_collectionmaintenanceanddisplayorganization)) )
     => tptpofobject(INS,f_tptpquantityfn_20(n_651)) ) )).

fof(ax3_2701,axiom,
    ( mtvisible(c_tptp_member2278_mt)
   => relationallinstance(c_tptpofobject,f_facilitytypeoforganizationtypefn(c_collectionmaintenanceanddisplayorganization),f_tptpquantityfn_20(n_651)) )).

% Cyc Assertion #345234:
fof(ax3_2702,axiom,(
    genlmt(c_miptdatabase19982002mt,c_basekb) )).

% Cyc Assertion #1347308:
fof(ax3_2703,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeopleaandrewsdonaldftppypeopleaandrewsdonaldcanadaright)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #1644434:
fof(ax3_2704,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_22),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1225234:
fof(ax3_2705,axiom,(
    genlmt(c_oldlatinlexicalmt,c_basekb) )).

% Cyc Assertion #2096671:
fof(ax3_2706,axiom,(
    genls(c_tptpcol_7_109570,c_tptpcol_6_108546) )).

fof(ax3_2707,axiom,(
    ! [OBJ] :
      ( tptpcol_7_109570(OBJ)
     => tptpcol_6_108546(OBJ) ) )).

% Cyc Assertion #723046:
fof(ax3_2708,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_meaninginsystemfn(c_sensus_information1997,s_striving))
     => intangibleindividual(OBJ) ) )).

fof(ax3_2709,axiom,(
    genls(f_meaninginsystemfn(c_sensus_information1997,s_striving),c_intangibleindividual) )).

fof(ax3_2710,axiom,(
    ! [OBJ] :
      ( meaninginsystemfnsensus_information1997striving(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #547783:
fof(ax3_2711,axiom,(
    genls(c_ql_chemical,c_partiallytangible) )).

fof(ax3_2712,axiom,(
    ! [OBJ] :
      ( ql_chemical(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1270746:
fof(ax3_2713,axiom,(
    genlmt(f_contextofpcwfn(c_christianlawsystem),c_humansociallifemt) )).

% Cyc Assertion #1744490:
fof(ax3_2714,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_anti_tankshellattack,c_actiononobject,s_34146a86_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_2715,axiom,(
    genls(f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_anti_tankshellattack,c_actiononobject,s_34146a86_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_2716,axiom,(
    ! [OBJ] :
      ( unsatisfactoryattempttofnpropersubcollectionnamedfn_ternaryanti_tankshellattackactiononobject34146a86_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1077665:
fof(ax3_2717,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsbtseduresourcespublicationssbjt19991999fall3pdf)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1868840:
fof(ax3_2718,axiom,(
    genls(c_tptpcol_7_18437,c_tptpcol_6_18436) )).

fof(ax3_2719,axiom,(
    ! [OBJ] :
      ( tptpcol_7_18437(OBJ)
     => tptpcol_6_18436(OBJ) ) )).

% Cyc Assertion #1570911:
fof(ax3_2720,axiom,(
    genlmt(f_contextofpcwfn(c_iranschangingrelationshipwithhezbollah),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #2363694:
fof(ax3_2721,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3954_mt)
        & silver(INS) )
     => tptpofobject(INS,f_tptpquantityfn_19(n_306)) ) )).

fof(ax3_2722,axiom,
    ( mtvisible(c_tptp_member3954_mt)
   => relationallinstance(c_tptpofobject,c_silver,f_tptpquantityfn_19(n_306)) )).

% Cyc Assertion #2183650:
fof(ax3_2723,axiom,(
    genlmt(c_tptp_member3179_mt,c_basekb) )).

% Cyc Assertion #1192081:
fof(ax3_2724,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_greensfarnleyandwortleywardinforeservoir_dog_joins_greenshtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2282832:
fof(ax3_2725,axiom,
    ( mtvisible(c_cyclistsmt)
   => isa(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_982,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )).

fof(ax3_2726,axiom,
    ( mtvisible(c_cyclistsmt)
   => subcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_982) )).

% Cyc Assertion #415639:
fof(ax3_2727,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtheologyedub701htm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #279943:
fof(ax3_2728,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpowellscomsubsectionaudiobooksbiographies4html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1114269:
fof(ax3_2729,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikibeloved_novel)),c_translation_1),c_basekb) )).

% Cyc Assertion #491184:
fof(ax3_2730,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0870541811vglance)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1684668:
fof(ax3_2731,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_131125260calendareventshtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2178207:
fof(ax3_2732,axiom,(
    genlmt(c_tptp_member1818_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #345263:
fof(ax3_2733,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsearchgodswordorgcombccviewcgibookrochapter005)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1515522:
fof(ax3_2734,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertoffset0)),c_translation_28),c_basekb) )).

% Cyc Assertion #1335554:
fof(ax3_2735,axiom,(
    genlmt(c_bayesnetspindleheadmt,c_basekb) )).

% Cyc Assertion #541461:
fof(ax3_2736,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwteenreadscomreviews0679751130asp)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #911757:
fof(ax3_2737,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfactmonstercomipkaa0761438html)),c_translation_12),c_basekb) )).

% Cyc Assertion #2180778:
fof(ax3_2738,axiom,(
    genlmt(c_tptp_member2461_mt,c_basekb) )).

% Cyc Assertion #1545204:
fof(ax3_2739,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_commonplacebooktripodcomid8html)),c_translation_33),c_basekb) )).

% Cyc Assertion #2247809:
fof(ax3_2740,axiom,
    ( mtvisible(c_tptp_member371_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_51) )).

% Cyc Assertion #975124:
fof(ax3_2741,axiom,(
    genlmt(f_contentmtfn(c_gndb_geo_ref_coords_ks),c_basekb) )).

% Cyc Assertion #2179866:
fof(ax3_2742,axiom,(
    genlmt(c_tptp_member2233_mt,c_basekb) )).

% Cyc Assertion #2173214:
fof(ax3_2743,axiom,(
    genlmt(c_tptp_member570_mt,c_basekb) )).

% Cyc Assertion #251409:
fof(ax3_2744,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbelfastislamiccentreorgukvisitorsguidehtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #479097:
fof(ax3_2745,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_partiallytangible,c_aestheticqualityofthing,f_mediumamountfn(c_beauty)))
     => thing(OBJ) ) )).

fof(ax3_2746,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_partiallytangible,c_aestheticqualityofthing,f_mediumamountfn(c_beauty)),c_thing) )).

fof(ax3_2747,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnpartiallytangibleaestheticqualityofthingmediumamountfnbeauty(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #558102:
fof(ax3_2748,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmilnetcomafiafi_research_0216htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #273930:
fof(ax3_2749,axiom,(
    genls(c_nouncompoundruleindexicalterm_direct,c_individual) )).

fof(ax3_2750,axiom,(
    ! [OBJ] :
      ( nouncompoundruleindexicalterm_direct(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #981106:
fof(ax3_2751,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_timeline__syria),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #517264:
fof(ax3_2752,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomresearchtrianglelab4191millermillershtml)),c_translation_11),c_basekb) )).

% Cyc Assertion #548176:
fof(ax3_2753,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmesothelioma__attorneycomstatewashingtonhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #694306:
fof(ax3_2754,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_ambassador,c_personrepresentingagent,c_turkey))
     => individual(OBJ) ) )).

fof(ax3_2755,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_ambassador,c_personrepresentingagent,c_turkey),c_individual) )).

fof(ax3_2756,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnambassadorpersonrepresentingagentturkey(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #663747:
fof(ax3_2757,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplecftppypeoplecchristiedougcanadaright)),c_translation_0),c_basekb) )).

% Cyc Assertion #2181762:
fof(ax3_2758,axiom,(
    genlmt(c_tptp_member2707_mt,c_basekb) )).

% Cyc Assertion #1489103:
fof(ax3_2759,axiom,(
    genls(c_livestockroute,c_partiallytangible) )).

fof(ax3_2760,axiom,(
    ! [OBJ] :
      ( livestockroute(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2183338:
fof(ax3_2761,axiom,(
    genlmt(c_tptp_member3101_mt,c_basekb) )).

% Cyc Assertion #211815:
fof(ax3_2762,axiom,(
    genlmt(c_smt_factentry_templatemt,c_basekb) )).

% Cyc Assertion #602501:
fof(ax3_2763,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjerrylentzcomarchive2003_06_01_archivehtml)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1126944:
fof(ax3_2764,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwneverarycomn1n1umbrellahtm)),c_translation_9),c_basekb) )).

% Cyc Assertion #388087:
fof(ax3_2765,axiom,(
    genlmt(c_reasoningwithtense_logicmt_neutralplainmetricoperator,c_basekb) )).

% Cyc Assertion #494098:
fof(ax3_2766,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomrealmsofwisdomfantasyfantasy1html)),c_translation_2),c_basekb) )).

% Cyc Assertion #531967:
fof(ax3_2767,axiom,(
    genls(c_observationfacilitatingterrain,c_geographicalregion) )).

fof(ax3_2768,axiom,(
    ! [OBJ] :
      ( observationfacilitatingterrain(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1571491:
fof(ax3_2769,axiom,(
    genls(c_ethyldiethanolamine,c_partiallytangible) )).

fof(ax3_2770,axiom,(
    ! [OBJ] :
      ( ethyldiethanolamine(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #795219:
fof(ax3_2771,axiom,(
    genlmt(c_wamt_evalinitial_p5a,c_basekb) )).

% Cyc Assertion #1482179:
fof(ax3_2772,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmkbmemorialcominterviewsinvitedtalktrans)),c_translation_33),c_basekb) )).

% Cyc Assertion #934192:
fof(ax3_2773,axiom,(
    ! [OBJ] :
      ( collectionsubsetfnconsulthesetofobjthereexistsxandisaxembassy_themissionrelationinstanceexistsaffiliatedwithxsaudipersonpossessiverelationxobj(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #835497:
fof(ax3_2774,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkaraokeinfocoukforumforum_postsasptid887tpn2)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1129617:
fof(ax3_2775,axiom,
    ( mtvisible(c_worldgeographymt)
   => state_geopolitical(c_jinotega_departmentnicaragua) )).

% Cyc Assertion #1719314:
fof(ax3_2776,axiom,(
    genlmt(c_reportcontent_dla_j6_13019,c_basekb) )).

% Cyc Assertion #653079:
fof(ax3_2777,axiom,(
    genls(c_formulatemplatemicrotheory,c_microtheory) )).

fof(ax3_2778,axiom,(
    ! [OBJ] :
      ( formulatemplatemicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #1034967:
fof(ax3_2779,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwachievementorgautodocpagetan0int_4)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1777837:
fof(ax3_2780,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_librarythinkquestorg23846librarynovelsjaneeyre_01_novhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2178226:
fof(ax3_2781,axiom,(
    genlmt(c_tptp_member1823_mt,c_basekb) )).

% Cyc Assertion #2180455:
fof(ax3_2782,axiom,(
    genlmt(c_tptp_member2380_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1534819:
fof(ax3_2783,axiom,(
    genls(c_coastalregion,c_geographicalregion) )).

fof(ax3_2784,axiom,(
    ! [OBJ] :
      ( coastalregion(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1326036:
fof(ax3_2785,axiom,
    ( mtvisible(c_computerhardwarevocabularymt)
   => manufacturedgoodstype(c_highperformancecpu) )).

% Cyc Assertion #318425:
fof(ax3_2786,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstathanasiusorgbiblejul_2_2000html)),c_translation_32),c_basekb) )).

% Cyc Assertion #2182791:
fof(ax3_2787,axiom,(
    genlmt(c_tptp_member2964_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1135894:
fof(ax3_2788,axiom,
    ( mtvisible(c_intermediatevocabularymt)
   => arg2isa(c_some,c_setorcollection) )).

fof(ax3_2789,axiom,(
    ! [ARG1,ARG2] :
      ( ( mtvisible(c_intermediatevocabularymt)
        & some(ARG1,ARG2) )
     => setorcollection(ARG2) ) )).

% Cyc Assertion #2181502:
fof(ax3_2790,axiom,(
    genlmt(c_tptp_member2642_mt,c_basekb) )).

% Cyc Assertion #2236568:
fof(ax3_2791,axiom,(
    genlmt(c_tptpeverydaylifeanthropacity,c_basekb) )).

% Cyc Assertion #926424:
fof(ax3_2792,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwchroncomcontentchroniclefeaturesvideo97mainhtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #205048:
fof(ax3_2793,axiom,(
    genls(c_linearobject_threedimensional,c_thing) )).

fof(ax3_2794,axiom,(
    ! [OBJ] :
      ( linearobject_threedimensional(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #294896:
fof(ax3_2795,axiom,(
    genlmt(c_peoplemt,c_basekb) )).

% Cyc Assertion #752639:
fof(ax3_2796,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_armoredisraelimilitaryunit,c_partiallytangible,s_34032c73_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_2797,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_armoredisraelimilitaryunit,c_partiallytangible,s_34032c73_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_2798,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryarmoredisraelimilitaryunitpartiallytangible34032c73_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1695757:
fof(ax3_2799,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_s6invisionfreecom80s_cartoonsart2854htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1639598:
fof(ax3_2800,axiom,(
    genls(c_enduringthing_localized,c_spatialthing_nonsituational) )).

fof(ax3_2801,axiom,(
    ! [OBJ] :
      ( enduringthing_localized(OBJ)
     => spatialthing_nonsituational(OBJ) ) )).

% Cyc Assertion #2186454:
fof(ax3_2802,axiom,(
    genlmt(c_tptp_member3880_mt,c_basekb) )).

% Cyc Assertion #2359378:
fof(ax3_2803,axiom,(
    ! [INS] :
      ( ( mtvisible(c_cyclistsmt)
        & marina(INS) )
     => tptpofobject(INS,f_tptpquantityfn_8(n_160)) ) )).

fof(ax3_2804,axiom,
    ( mtvisible(c_cyclistsmt)
   => relationallinstance(c_tptpofobject,c_marina,f_tptpquantityfn_8(n_160)) )).

% Cyc Assertion #2180702:
fof(ax3_2805,axiom,(
    genlmt(c_tptp_member2442_mt,c_basekb) )).

% Cyc Assertion #1451217:
fof(ax3_2806,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetabandoned_existentialstatuspolicestation(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #707963:
fof(ax3_2807,axiom,(
    genlmt(c_fm90_7_fieldmanual,c_basekb) )).

% Cyc Assertion #923064:
fof(ax3_2808,axiom,(
    genlmt(c_unitedstatesgeographypeoplemt,c_basekb) )).

% Cyc Assertion #1405876:
fof(ax3_2809,axiom,(
    genls(c_icescraper,c_partiallytangible) )).

fof(ax3_2810,axiom,(
    ! [OBJ] :
      ( icescraper(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #506302:
fof(ax3_2811,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcolumbusalivecom200020000406music1html)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1521215:
fof(ax3_2812,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cgiebaycomwarning_world_demanding_god_inspired_story_manuscript_w0qqitemz7377202690qqcategoryz2196qqcmdzviewitem)),c_translation_31),c_basekb) )).

% Cyc Assertion #1356919:
fof(ax3_2813,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhouseofpoebigtownfilmpostersorgid22htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1550985:
fof(ax3_2814,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & isa(OBJ,f_chemicalsubstancefn(c_n2molecule)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_2815,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(f_chemicalsubstancefn(c_n2molecule),c_partiallytangible) )).

fof(ax3_2816,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & chemicalsubstancefnn2molecule(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1204843:
fof(ax3_2817,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #942203:
fof(ax3_2818,axiom,(
    ! [OBJ] :
      ( collectionsubsetfnpersonthesetofpersonthereexistsagencyandisaagencytaxagencypositionofpersoninorganizationpersonagencycommissioner_rank(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #416414:
fof(ax3_2819,axiom,(
    genlmt(c_scenariotestmt_7,c_basekb) )).

% Cyc Assertion #2183438:
fof(ax3_2820,axiom,(
    genlmt(c_tptp_member3126_mt,c_basekb) )).

% Cyc Assertion #1625671:
fof(ax3_2821,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_officerinorganization,c_domainsofspecialization,c_artifact_communication))
     => individual(OBJ) ) )).

fof(ax3_2822,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_officerinorganization,c_domainsofspecialization,c_artifact_communication),c_individual) )).

fof(ax3_2823,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnofficerinorganizationdomainsofspecializationartifact_communication(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #314633:
fof(ax3_2824,axiom,(
    genlmt(f_contentmtfn(c_cadre_event_functional_assc_ks),c_basekb) )).

% Cyc Assertion #1452610:
fof(ax3_2825,axiom,(
    genlmt(c_pq18_19mt,c_testvocabularymt) )).

% Cyc Assertion #980785:
fof(ax3_2826,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_bodyofwater,c_mainconstituent,c_water_saline))
     => partiallytangible(OBJ) ) )).

fof(ax3_2827,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_bodyofwater,c_mainconstituent,c_water_saline),c_partiallytangible) )).

fof(ax3_2828,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnbodyofwatermainconstituentwater_saline(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #643890:
fof(ax3_2829,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadianftppyorgscanadianchurch_of_the_creatorcanadaright)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #1672275:
fof(ax3_2830,axiom,(
    genlmt(c_knowledgefragmentt31mt,c_basekb) )).

% Cyc Assertion #277797:
fof(ax3_2831,axiom,(
    genlmt(f_contextofpcwfn(c_fbireporttojudgegaleanoonamiabombing),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #2185762:
fof(ax3_2832,axiom,(
    genlmt(c_tptp_member3707_mt,c_basekb) )).

% Cyc Assertion #586341:
fof(ax3_2833,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc33477)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1385897:
fof(ax3_2834,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_usamediamonitorsnetheadlinesmel_gibson_vs_abe_foxman_victory_for_first_amendment)),c_translation_32),c_basekb) )).

% Cyc Assertion #936846:
fof(ax3_2835,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprincetonreviewcomcteprofilesinternshipgeninfoaspinternshipid498)),c_translation_1),c_basekb) )).

% Cyc Assertion #207070:
fof(ax3_2836,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvdverdictcomreviewsflashdancephp)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #816678:
fof(ax3_2837,axiom,(
    transitivebinarypredicate(c_firstsubevents) )).

% Cyc Assertion #1252027:
fof(ax3_2838,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinfopleasecomipeaa0761438html)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #217587:
fof(ax3_2839,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrnscompages4action96html)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #553402:
fof(ax3_2840,axiom,(
    genls(c_medicalprobe,c_individual) )).

fof(ax3_2841,axiom,(
    ! [OBJ] :
      ( medicalprobe(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #319426:
fof(ax3_2842,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #646591:
fof(ax3_2843,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive20040915n61crtr29jarhtm)),c_translation_14),c_basekb) )).

% Cyc Assertion #2183682:
fof(ax3_2844,axiom,(
    genlmt(c_tptp_member3187_mt,c_basekb) )).

% Cyc Assertion #1425040:
fof(ax3_2845,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_3),c_basekb) )).

% Cyc Assertion #496699:
fof(ax3_2846,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_atraveldirectorycomttallahasseehtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1286354:
fof(ax3_2847,axiom,(
    genlmt(c_mathvocabularymt,c_basekb) )).

% Cyc Assertion #430614:
fof(ax3_2848,axiom,(
    genlmt(c_internationalsystemframeworkmt,c_basekb) )).

% Cyc Assertion #365249:
fof(ax3_2849,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomjames_cutter001rmhtm)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1097675:
fof(ax3_2850,axiom,(
    genlmt(c_academicorganizationmt,c_basekb) )).

% Cyc Assertion #2172218:
fof(ax3_2851,axiom,(
    genlmt(c_tptp_member321_mt,c_basekb) )).

% Cyc Assertion #408988:
fof(ax3_2852,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_m0fdnis_4_9ai_n9480678pg_17)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #247313:
fof(ax3_2853,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #151982:
fof(ax3_2854,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_8),c_basekb) )).

% Cyc Assertion #746449:
fof(ax3_2855,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_moneycnncommagazinesfortunefortune_archive200512128363101)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1523279:
fof(ax3_2856,axiom,(
    uniformresourcelocator(f_urlfn(s_http_statichighbeamcomthejakartapostapril222002)) )).

% Cyc Assertion #1603694:
fof(ax3_2857,axiom,(
    genlmt(c_charliecriterion1_infoconcriterionmt,c_basekb) )).

% Cyc Assertion #2477256:
fof(ax3_2858,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x1_y18) )).

% Cyc Assertion #188696:
fof(ax3_2859,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #422062:
fof(ax3_2860,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_28),c_basekb) )).

% Cyc Assertion #1042016:
fof(ax3_2861,axiom,(
    genlmt(f_contextofpcwfn(c_2001_aspaceodyssey_thenarrative),c_humansociallifemt) )).

% Cyc Assertion #330974:
fof(ax3_2862,axiom,
    ( mtvisible(c_christianitymt)
   => genlmt(c_worldmythologymt,c_basekb) )).

% Cyc Assertion #1104091:
fof(ax3_2863,axiom,(
    genlmt(c_relationexamplesmt,c_ethnicgroupsvocabularymt) )).

% Cyc Assertion #724087:
fof(ax3_2864,axiom,(
    genlmt(f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1998))),c_keinteractionresourcetestmt) )).

% Cyc Assertion #1238750:
fof(ax3_2865,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwanswerscomtopicmeasles)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2181666:
fof(ax3_2866,axiom,(
    genlmt(c_tptp_member2683_mt,c_basekb) )).

% Cyc Assertion #2184486:
fof(ax3_2867,axiom,(
    genlmt(c_tptp_member3388_mt,c_basekb) )).

% Cyc Assertion #2172134:
fof(ax3_2868,axiom,(
    genlmt(c_tptp_member300_mt,c_basekb) )).

% Cyc Assertion #1537848:
fof(ax3_2869,axiom,(
    individual(f_urlfn(f_urlfn(s_http_wwwcollectorcafecomarticle_archiveasparticle20id1939))) )).

% Cyc Assertion #2175014:
fof(ax3_2870,axiom,(
    genlmt(c_tptp_member1020_mt,c_basekb) )).

% Cyc Assertion #543651:
fof(ax3_2871,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcrimelibrarycomterrorists_spiesterroristselsayid_nosair8htmlsect7)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #771644:
fof(ax3_2872,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikitalk_persian_language)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #445439:
fof(ax3_2873,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjeanrenooffset0)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #550223:
fof(ax3_2874,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wildcatarizonaedupapers911407_1_mhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #806180:
fof(ax3_2875,axiom,(
    genlmt(f_contextofpcwfn(c_thematrix_themovie),c_basekb) )).

% Cyc Assertion #2172318:
fof(ax3_2876,axiom,(
    genlmt(c_tptp_member346_mt,c_basekb) )).

% Cyc Assertion #2173906:
fof(ax3_2877,axiom,(
    genlmt(c_tptp_member743_mt,c_basekb) )).

% Cyc Assertion #1089431:
fof(ax3_2878,axiom,(
    genls(c_bbnentitytype,c_collection) )).

fof(ax3_2879,axiom,(
    ! [OBJ] :
      ( bbnentitytype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1047943:
fof(ax3_2880,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsawncomindexphpltypecatcategory1filmsnewsitem_no11515dir1)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #909205:
fof(ax3_2881,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpowellscombiblio0440498058)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2186022:
fof(ax3_2882,axiom,(
    genlmt(c_tptp_member3772_mt,c_basekb) )).

% Cyc Assertion #2181542:
fof(ax3_2883,axiom,(
    genlmt(c_tptp_member2652_mt,c_basekb) )).

% Cyc Assertion #1324172:
fof(ax3_2884,axiom,(
    genlmt(f_contextofpcwfn(c_donoteatwithlefthand),c_basekb) )).

% Cyc Assertion #527630:
fof(ax3_2885,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1651090:
fof(ax3_2886,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtheologywebsitecomntcorinthiansshtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #446893:
fof(ax3_2887,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_priceseekeryo_storecompssling_blade)),c_translation_32),c_basekb) )).

% Cyc Assertion #238905:
fof(ax3_2888,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_crybinsmobtextamericacom)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1279989:
fof(ax3_2889,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcarlhiaasencom)),c_translation_28),c_basekb) )).

% Cyc Assertion #185465:
fof(ax3_2890,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcolumbusalivecom200020000406music1html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1622949:
fof(ax3_2891,axiom,(
    genlmt(c_rawims_momt,c_basekb) )).

% Cyc Assertion #717239:
fof(ax3_2892,axiom,(
    genlmt(c_retailbuyingmt,c_basekb) )).

% Cyc Assertion #1775587:
fof(ax3_2893,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwciaocoukvaletta_malta__90684)),c_translation_33),c_basekb) )).

% Cyc Assertion #1060912:
fof(ax3_2894,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_lifsostypepadcomlulled_into_a_false_sense200509)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #738538:
fof(ax3_2895,axiom,(
    genls(c_uiacomputerdisplaymenuitem,c_individual) )).

fof(ax3_2896,axiom,(
    ! [OBJ] :
      ( uiacomputerdisplaymenuitem(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2185678:
fof(ax3_2897,axiom,(
    genlmt(c_tptp_member3686_mt,c_basekb) )).

% Cyc Assertion #728555:
fof(ax3_2898,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_7),c_basekb) )).

% Cyc Assertion #442195:
fof(ax3_2899,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwftmeadearmymilsoundoffarchivesso2002feb21html02_21news_groupshtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #578528:
fof(ax3_2900,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwerasingcloudscom07janhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1777044:
fof(ax3_2901,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_websitesexpercraftcomn51pwindexphpqlog_entrylog_id4868)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2179450:
fof(ax3_2902,axiom,(
    genlmt(c_tptp_member2129_mt,c_basekb) )).

% Cyc Assertion #1636630:
fof(ax3_2903,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdailyillinicomnews20041214featuresconservatismontheriseinyoungvoters_828816shtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #1367249:
fof(ax3_2904,axiom,(
    list(c_temporalqualificationofpropositions_time_csc) )).

% Cyc Assertion #1700485:
fof(ax3_2905,axiom,(
    genls(c_giftbaskettypebyoccasion,c_collection) )).

fof(ax3_2906,axiom,(
    ! [OBJ] :
      ( giftbaskettypebyoccasion(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1179453:
fof(ax3_2907,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwahdahnetprefhtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #529001:
fof(ax3_2908,axiom,(
    genls(c_alphainfoconlevelsecurityscript,c_individual) )).

fof(ax3_2909,axiom,(
    ! [OBJ] :
      ( alphainfoconlevelsecurityscript(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #161068:
fof(ax3_2910,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbiblestudyorgmaturartnamegodpdf)),c_translation_33),c_basekb) )).

% Cyc Assertion #1598041:
fof(ax3_2911,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsaramacomforumsshowthreadphpthreadid35479)),c_translation_31),c_basekb) )).

% Cyc Assertion #1735419:
fof(ax3_2912,axiom,(
    genls(c_transportingmilitarycargo,c_individual) )).

fof(ax3_2913,axiom,(
    ! [OBJ] :
      ( transportingmilitarycargo(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #818467:
fof(ax3_2914,axiom,(
    genlmt(f_contextofpcwfn(f_etiquetteofculturefn(f_nationalculturefn(c_bahrain))),c_humansociallifemt) )).

% Cyc Assertion #1109776:
fof(ax3_2915,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwphoenixnewtimescomissues2005_12_22cultureart2html)),c_translation_33),c_basekb) )).

% Cyc Assertion #986210:
fof(ax3_2916,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_13),c_basekb) )).

% Cyc Assertion #1473451:
fof(ax3_2917,axiom,(
    genlmt(c_timehasnoendmt,c_generictemporalmt) )).

% Cyc Assertion #2155292:
fof(ax3_2918,axiom,(
    genlpreds(c_tptptypes_9_694,c_tptptypes_8_692) )).

fof(ax3_2919,axiom,(
    ! [ARG1,ARG2] :
      ( tptptypes_9_694(ARG1,ARG2)
     => tptptypes_8_692(ARG1,ARG2) ) )).

% Cyc Assertion #160813:
fof(ax3_2920,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwiueduusersmfwcwiugreatgatsbyhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1621920:
fof(ax3_2921,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoutherncteduorganizationshcr2002nonfictioncooperhtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1822756:
fof(ax3_2922,axiom,(
    genls(c_tptpcol_2_2,c_tptpcol_1_1) )).

fof(ax3_2923,axiom,(
    ! [OBJ] :
      ( tptpcol_2_2(OBJ)
     => tptpcol_1_1(OBJ) ) )).

% Cyc Assertion #2252222:
fof(ax3_2924,axiom,
    ( mtvisible(c_cyclistsmt)
   => isa(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_520,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )).

fof(ax3_2925,axiom,
    ( mtvisible(c_cyclistsmt)
   => subcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_520) )).

% Cyc Assertion #1522332:
fof(ax3_2926,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive200409)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175642:
fof(ax3_2927,axiom,(
    genlmt(c_tptp_member1177_mt,c_basekb) )).

% Cyc Assertion #680868:
fof(ax3_2928,axiom,(
    genls(c_sawpalmetto_drug,c_individual) )).

fof(ax3_2929,axiom,(
    ! [OBJ] :
      ( sawpalmetto_drug(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2423562:
fof(ax3_2930,axiom,(
    individual(c_tptpstyrenemonomer_3) )).

% Cyc Assertion #2376758:
fof(ax3_2931,axiom,(
    individual(c_tptphalloweendecoration) )).

% Cyc Assertion #2463532:
fof(ax3_2932,axiom,(
    individual(c_georegion_l3_x9_y20) )).

% Cyc Assertion #2177814:
fof(ax3_2933,axiom,(
    genlmt(c_tptp_member1720_mt,c_basekb) )).

% Cyc Assertion #1093151:
fof(ax3_2934,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpatientcoukshowdoc23068988)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1127404:
fof(ax3_2935,axiom,(
    genls(c_situation_pla001_1,c_individual) )).

fof(ax3_2936,axiom,(
    ! [OBJ] :
      ( situation_pla001_1(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2186290:
fof(ax3_2937,axiom,(
    genlmt(c_tptp_member3839_mt,c_basekb) )).

% Cyc Assertion #2176278:
fof(ax3_2938,axiom,(
    genlmt(c_tptp_member1336_mt,c_basekb) )).

% Cyc Assertion #555095:
fof(ax3_2939,axiom,(
    genls(c_cycinternaltask_researchcyc_project_the_44,c_individual) )).

fof(ax3_2940,axiom,(
    ! [OBJ] :
      ( cycinternaltask_researchcyc_project_the_44(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #233990:
fof(ax3_2941,axiom,(
    genlmt(c_animalactivitiesmt,c_basekb) )).

% Cyc Assertion #1338077:
fof(ax3_2942,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_mihtm)),c_translation_13),c_basekb) )).

% Cyc Assertion #1600948:
fof(ax3_2943,axiom,
    ( mtvisible(c_computerhardwarevocabularymt)
   => computerhardwaredevicetype(c_computermonitorcable) )).

% Cyc Assertion #1556345:
fof(ax3_2944,axiom,(
    genlmt(c_textualinferencecontentmodelcreationtemplatemt,c_testvocabularymt) )).

% Cyc Assertion #208597:
fof(ax3_2945,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgowaycomafricama_sightseeinghtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1685133:
fof(ax3_2946,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnowtorontocomissues2004_10_07music_discs2_phtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #2477855:
fof(ax3_2947,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x23_y23) )).

% Cyc Assertion #434721:
fof(ax3_2948,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_enduringthing_localized,c_inregion,f_citynamedfn(s_toribio,c_colombia)))
     => spatialthing_nonsituational(OBJ) ) )).

fof(ax3_2949,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_enduringthing_localized,c_inregion,f_citynamedfn(s_toribio,c_colombia)),c_spatialthing_nonsituational) )).

fof(ax3_2950,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnenduringthing_localizedinregioncitynamedfntoribiocolombia(OBJ)
     => spatialthing_nonsituational(OBJ) ) )).

% Cyc Assertion #2174906:
fof(ax3_2951,axiom,(
    genlmt(c_tptp_member993_mt,c_basekb) )).

% Cyc Assertion #1553818:
fof(ax3_2952,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineseatscomwill_smith_ticketsindexasp)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1308514:
fof(ax3_2953,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinformationblastcomtechnical_university_of_munichhtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #542693:
fof(ax3_2954,axiom,(
    genls(c_objecttypebystyle,c_collection) )).

fof(ax3_2955,axiom,(
    ! [OBJ] :
      ( objecttypebystyle(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #2173494:
fof(ax3_2956,axiom,(
    genlmt(c_tptp_member640_mt,c_basekb) )).

% Cyc Assertion #2176482:
fof(ax3_2957,axiom,(
    genlmt(c_tptp_member1387_mt,c_basekb) )).

% Cyc Assertion #1844900:
fof(ax3_2958,axiom,(
    firstordercollection(c_tptpcol_16_8864) )).

% Cyc Assertion #2181938:
fof(ax3_2959,axiom,(
    genlmt(c_tptp_member2751_mt,c_basekb) )).

% Cyc Assertion #1509285:
fof(ax3_2960,axiom,(
    genls(c_wordnetsynsetworkflowstatus,c_collection) )).

fof(ax3_2961,axiom,(
    ! [OBJ] :
      ( wordnetsynsetworkflowstatus(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #430351:
fof(ax3_2962,axiom,(
    genlmt(c_queensguardbandimt,c_basekb) )).

% Cyc Assertion #589865:
fof(ax3_2963,axiom,(
    genlmt(c_scenariogenerationactionplannermt,c_basekb) )).

% Cyc Assertion #815503:
fof(ax3_2964,axiom,(
    genlmt(c_easytmsloopmt,c_basekb) )).

% Cyc Assertion #1700683:
fof(ax3_2965,axiom,(
    genlmt(c_bbninterestingnessrulesmt,c_worldgeographydualistmt) )).

% Cyc Assertion #2179950:
fof(ax3_2966,axiom,(
    genlmt(c_tptp_member2254_mt,c_basekb) )).

% Cyc Assertion #1539624:
fof(ax3_2967,axiom,(
    genls(c_workstation,c_artifact) )).

fof(ax3_2968,axiom,(
    ! [OBJ] :
      ( workstation(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1992921:
fof(ax3_2969,axiom,(
    firstordercollection(c_tptpcol_14_68072) )).

% Cyc Assertion #918569:
fof(ax3_2970,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsegulletorgindexphpshowtopic42218)),c_translation_2),c_basekb) )).

% Cyc Assertion #702544:
fof(ax3_2971,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_29),c_basekb) )).

% Cyc Assertion #194558:
fof(ax3_2972,axiom,(
    genlmt(c_ctcwhoisquerymt,c_basekb) )).

% Cyc Assertion #1087497:
fof(ax3_2973,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcenedracomtpdavidlynch2htm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #173276:
fof(ax3_2974,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwauafmilauawcawcgatedodn02142002_200202141htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #2186886:
fof(ax3_2975,axiom,(
    genlmt(c_tptp_member3988_mt,c_basekb) )).

% Cyc Assertion #2178086:
fof(ax3_2976,axiom,(
    genlmt(c_tptp_member1788_mt,c_basekb) )).

% Cyc Assertion #575226:
fof(ax3_2977,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_24),c_basekb) )).

% Cyc Assertion #2178990:
fof(ax3_2978,axiom,(
    genlmt(c_tptp_member2014_mt,c_basekb) )).

% Cyc Assertion #1293243:
fof(ax3_2979,axiom,(
    genlmt(c_pq10mt,c_basekb) )).

% Cyc Assertion #2184702:
fof(ax3_2980,axiom,(
    genlmt(c_tptp_member3442_mt,c_basekb) )).

% Cyc Assertion #2185574:
fof(ax3_2981,axiom,(
    genlmt(c_tptp_member3660_mt,c_basekb) )).

% Cyc Assertion #1580418:
fof(ax3_2982,axiom,(
    genls(c_freelyaccessiblewwwdatabase,c_aspatialinformationstore) )).

fof(ax3_2983,axiom,(
    ! [OBJ] :
      ( freelyaccessiblewwwdatabase(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1708655:
fof(ax3_2984,axiom,(
    genlmt(c_pq66a_67a_68mt,c_testvocabularymt) )).

% Cyc Assertion #2182798:
fof(ax3_2985,axiom,(
    genlmt(c_tptp_member2966_mt,c_basekb) )).

% Cyc Assertion #502473:
fof(ax3_2986,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_workersterminalcrossing,c_partiallytangible,s_3416db84_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_2987,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_workersterminalcrossing,c_partiallytangible,s_3416db84_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_2988,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryworkersterminalcrossingpartiallytangible3416db84_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #518759:
fof(ax3_2989,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjerrylentzcomarchive2003_06_01_archivehtml)),c_translation_28),c_basekb) )).

% Cyc Assertion #209331:
fof(ax3_2990,axiom,(
    genls(c_persontypebyeuropeanzodiacsign,c_collection) )).

fof(ax3_2991,axiom,(
    ! [OBJ] :
      ( persontypebyeuropeanzodiacsign(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #393309:
fof(ax3_2992,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmccchurchorgmncstatement20of20call20to20be20the20next20moderator20of20ufmccdoc)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1877881:
fof(ax3_2993,axiom,(
    genls(c_tptpcol_12_22055,c_tptpcol_11_22023) )).

fof(ax3_2994,axiom,(
    ! [OBJ] :
      ( tptpcol_12_22055(OBJ)
     => tptpcol_11_22023(OBJ) ) )).

% Cyc Assertion #1327955:
fof(ax3_2995,axiom,(
    individual(f_urlfn(s_http_wwwfairvieworghealthlibrarycontentaha_als_shahtm)) )).

% Cyc Assertion #1524411:
fof(ax3_2996,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_freerepubliccomfocuskeywordkgenerationy)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1123893:
fof(ax3_2997,axiom,(
    genlmt(c_miptdatabase19982002_termsmt,c_basekb) )).

% Cyc Assertion #412629:
fof(ax3_2998,axiom,(
    genls(c_obstruction_constructionartifact,c_partiallytangible) )).

fof(ax3_2999,axiom,(
    ! [OBJ] :
      ( obstruction_constructionartifact(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #524830:
fof(ax3_3000,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2477621:
fof(ax3_3001,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x15_y5) )).

% Cyc Assertion #1085862:
fof(ax3_3002,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_abcnetaunewenglandmornings)),c_translation_2),c_basekb) )).

% Cyc Assertion #887347:
fof(ax3_3003,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_trishwilsontypepadcomblog200503why_are_women_dhtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2186314:
fof(ax3_3004,axiom,(
    genlmt(c_tptp_member3845_mt,c_basekb) )).

% Cyc Assertion #1087165:
fof(ax3_3005,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_azilal_provincemorocco) )).

% Cyc Assertion #628357:
fof(ax3_3006,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_fcitcoeduusfedufloridalessonstallahasseetallahassee1pdf)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2177679:
fof(ax3_3007,axiom,(
    genlmt(c_tptp_member1686_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #219913:
fof(ax3_3008,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_s6invisionfreecom80s_cartoonsindexphpshowtopic2854viewgetnewpost)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1482001:
fof(ax3_3009,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthedailybulletincompostcardsmar9chtm)),c_translation_3),c_basekb) )).

% Cyc Assertion #432824:
fof(ax3_3010,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentfilm4009157stm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1183880:
fof(ax3_3011,axiom,(
    arg2isa(c_few,c_setorcollection) )).

fof(ax3_3012,axiom,(
    ! [ARG1,ARG2] :
      ( few(ARG1,ARG2)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #177049:
fof(ax3_3013,axiom,(
    genls(c_diamond_gem,c_artifact) )).

fof(ax3_3014,axiom,(
    ! [OBJ] :
      ( diamond_gem(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1709541:
fof(ax3_3015,axiom,(
    genlmt(c_southafricanenglishmt,c_basekb) )).

% Cyc Assertion #1272414:
fof(ax3_3016,axiom,(
    genlmt(c_scenariotestmt_7,c_basekb) )).

% Cyc Assertion #2175498:
fof(ax3_3017,axiom,(
    genlmt(c_tptp_member1141_mt,c_basekb) )).

% Cyc Assertion #1432270:
fof(ax3_3018,axiom,(
    genlmt(c_learnbyreadingdocumentdatamt,c_basekb) )).

% Cyc Assertion #1102801:
fof(ax3_3019,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnypresscom1537filmfilmcfm)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1557821:
fof(ax3_3020,axiom,
    ( mtvisible(c_modalitymt)
   => arg2isa(c_modalopset1_2fn,c_setorcollection) )).

% Cyc Assertion #1531273:
fof(ax3_3021,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_31),c_basekb) )).

% Cyc Assertion #2174274:
fof(ax3_3022,axiom,(
    genlmt(c_tptp_member835_mt,c_basekb) )).

% Cyc Assertion #1221586:
fof(ax3_3023,axiom,(
    genlmt(c_pq101bmt,c_testvocabularymt) )).

% Cyc Assertion #2174990:
fof(ax3_3024,axiom,(
    genlmt(c_tptp_member1014_mt,c_basekb) )).

% Cyc Assertion #437078:
fof(ax3_3025,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_9),c_basekb) )).

% Cyc Assertion #1276938:
fof(ax3_3026,axiom,(
    genlmt(c_syntaxspecificationvocabularymt,c_basekb) )).

% Cyc Assertion #611074:
fof(ax3_3027,axiom,(
    genlmt(c_unitedstatesmodernmilitaryvehiclesdatamt,c_basekb) )).

% Cyc Assertion #214024:
fof(ax3_3028,axiom,(
    genlmt(c_nondatacollectormt,c_basekb) )).

% Cyc Assertion #2174414:
fof(ax3_3029,axiom,(
    genlmt(c_tptp_member870_mt,c_basekb) )).

% Cyc Assertion #165835:
fof(ax3_3030,axiom,(
    genlmt(c_geocentricphysicsmt,c_basekb) )).

% Cyc Assertion #1034518:
fof(ax3_3031,axiom,(
    genlmt(f_contextofpcwfn(c_customarylawsystem),c_basekb) )).

% Cyc Assertion #1469969:
fof(ax3_3032,axiom,(
    genlmt(c_mtafterhormuzblocking,c_hpkbvocabmt) )).

% Cyc Assertion #418632:
fof(ax3_3033,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_socialbeing))
     => partiallytangible(OBJ) ) )).

fof(ax3_3034,axiom,(
    genls(f_groupfn(c_socialbeing),c_partiallytangible) )).

fof(ax3_3035,axiom,(
    ! [OBJ] :
      ( groupfnsocialbeing(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1614214:
fof(ax3_3036,axiom,(
    genls(c_physicalstuffandobjects_topic,c_thing) )).

fof(ax3_3037,axiom,(
    ! [OBJ] :
      ( physicalstuffandobjects_topic(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1515728:
fof(ax3_3038,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertlahroffset0)),c_translation_30),c_basekb) )).

% Cyc Assertion #1181855:
fof(ax3_3039,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwphoenixnewtimescomissues2005_12_22cultureart2html)),c_translation_31),c_basekb) )).

% Cyc Assertion #1441983:
fof(ax3_3040,axiom,(
    genlmt(c_englishjargonmt,c_basekb) )).

% Cyc Assertion #771168:
fof(ax3_3041,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_25),c_basekb) )).

% Cyc Assertion #1272303:
fof(ax3_3042,axiom,(
    genlmt(c_computervulnerabilitymt,c_basekb) )).

% Cyc Assertion #176655:
fof(ax3_3043,axiom,(
    genlmt(c_rkfconcealmentusecaseap_scriptmt,c_basekb) )).

% Cyc Assertion #2186818:
fof(ax3_3044,axiom,(
    genlmt(c_tptp_member3971_mt,c_basekb) )).

% Cyc Assertion #2180454:
fof(ax3_3045,axiom,(
    genlmt(c_tptp_member2380_mt,c_basekb) )).

% Cyc Assertion #2182378:
fof(ax3_3046,axiom,(
    genlmt(c_tptp_member2861_mt,c_basekb) )).

% Cyc Assertion #2176036:
fof(ax3_3047,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member1275_mt) )).

% Cyc Assertion #1179902:
fof(ax3_3048,axiom,(
    arg2isa(f_correspondinggenquantfn(c_most_nlattr),c_setorcollection) )).

% Cyc Assertion #1039519:
fof(ax3_3049,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & isa(OBJ,f_chemicalsubstancefn(c_carbonylgroup)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_3050,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(f_chemicalsubstancefn(c_carbonylgroup),c_partiallytangible) )).

fof(ax3_3051,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & chemicalsubstancefncarbonylgroup(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #958092:
fof(ax3_3052,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1738647:
fof(ax3_3053,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplecchristiedougftppypeoplecchristiedougcanadaright)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1547563:
fof(ax3_3054,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richmondthenandnowcomfamous_people_richmond_4html)),c_translation_28),c_basekb) )).

% Cyc Assertion #2179198:
fof(ax3_3055,axiom,(
    genlmt(c_tptp_member2066_mt,c_basekb) )).

% Cyc Assertion #262544:
fof(ax3_3056,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_23),c_basekb) )).

% Cyc Assertion #275855:
fof(ax3_3057,axiom,(
    genls(c_displayingauialink,c_individual) )).

fof(ax3_3058,axiom,(
    ! [OBJ] :
      ( displayingauialink(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1160157:
fof(ax3_3059,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcarlhiaasencom)),c_translation_31),c_basekb) )).

% Cyc Assertion #2171090:
fof(ax3_3060,axiom,(
    genlmt(c_tptp_member39_mt,c_basekb) )).

% Cyc Assertion #484665:
fof(ax3_3061,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_34),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1751479:
fof(ax3_3062,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_19),c_basekb) )).

% Cyc Assertion #2475072:
fof(ax3_3063,axiom,(
    individual(c_geolocation_x55_y58) )).

% Cyc Assertion #1078489:
fof(ax3_3064,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172210:
fof(ax3_3065,axiom,(
    genlmt(c_tptp_member319_mt,c_basekb) )).

% Cyc Assertion #2183654:
fof(ax3_3066,axiom,(
    genlmt(c_tptp_member3180_mt,c_basekb) )).

% Cyc Assertion #175261:
fof(ax3_3067,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwuniversitysportcaestory_detailcfmid6284)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #287105:
fof(ax3_3068,axiom,(
    genlmt(c_mtforcp_q41,c_hpkbvocabmt) )).

% Cyc Assertion #2178506:
fof(ax3_3069,axiom,(
    genlmt(c_tptp_member1893_mt,c_basekb) )).

% Cyc Assertion #272299:
fof(ax3_3070,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_12),c_machinelearningspindleheadmt) )).

% Cyc Assertion #190122:
fof(ax3_3071,axiom,(
    applicationcontext(c_readingtextvisualizationquerymt) )).

% Cyc Assertion #665900:
fof(ax3_3072,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_politicsguardiancoukforeignaffairscomment011538167628800html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1430092:
fof(ax3_3073,axiom,(
    subcollectiondenotingfunction(c_nlphrasewithframefn) )).

% Cyc Assertion #777818:
fof(ax3_3074,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_24),c_basekb) )).

% Cyc Assertion #1807326:
fof(ax3_3075,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_person,c_conceptuallyrelated,c_commercialactivity))
     => thing(OBJ) ) )).

fof(ax3_3076,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_person,c_conceptuallyrelated,c_commercialactivity),c_thing) )).

fof(ax3_3077,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnpersonconceptuallyrelatedcommercialactivity(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1450750:
fof(ax3_3078,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgotquestionsorgbook_of_1_corinthianshtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #705720:
fof(ax3_3079,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkimmccallorgwritingspnhpnhhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #2007074:
fof(ax3_3080,axiom,(
    genls(c_tptpcol_4_73730,c_tptpcol_3_65538) )).

fof(ax3_3081,axiom,(
    ! [OBJ] :
      ( tptpcol_4_73730(OBJ)
     => tptpcol_3_65538(OBJ) ) )).

% Cyc Assertion #2181454:
fof(ax3_3082,axiom,(
    genlmt(c_tptp_member2630_mt,c_basekb) )).

% Cyc Assertion #335370:
fof(ax3_3083,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_dossier_maher_assad),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1779691:
fof(ax3_3084,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_thencmodifier))
     => individual(OBJ) ) )).

fof(ax3_3085,axiom,(
    genls(f_groupfn(c_thencmodifier),c_individual) )).

fof(ax3_3086,axiom,(
    ! [OBJ] :
      ( groupfnthencmodifier(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1326275:
fof(ax3_3087,axiom,(
    genlmt(f_contextofpcwfn(c_fairdebtcollectionpracticesact),c_humansociallifemt) )).

% Cyc Assertion #606208:
fof(ax3_3088,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmetafiltercommefi45676)),c_translation_0),c_basekb) )).

% Cyc Assertion #1484954:
fof(ax3_3089,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikiuser_niteowlneilsactors_a_b)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #356096:
fof(ax3_3090,axiom,(
    genls(c_aspatialinformationstore,c_aspatialthing) )).

fof(ax3_3091,axiom,(
    ! [OBJ] :
      ( aspatialinformationstore(OBJ)
     => aspatialthing(OBJ) ) )).

% Cyc Assertion #359783:
fof(ax3_3092,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_9),c_basekb) )).

% Cyc Assertion #1481241:
fof(ax3_3093,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_personwithoccupation,c_worksatfacility,c_checkpoint_military))
     => partiallytangible(OBJ) ) )).

fof(ax3_3094,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_personwithoccupation,c_worksatfacility,c_checkpoint_military),c_partiallytangible) )).

fof(ax3_3095,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnpersonwithoccupationworksatfacilitycheckpoint_military(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #875225:
fof(ax3_3096,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_atlantaindymediaorgnewswiredisplay19045)),c_translation_0),c_basekb) )).

% Cyc Assertion #1152378:
fof(ax3_3097,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_fcitusfedufloridalessonstallahasseetallahasseehtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #156115:
fof(ax3_3098,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinthepinktexascomindexphpm20051103)),c_translation_2),c_basekb) )).

% Cyc Assertion #2362321:
fof(ax3_3099,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3207_mt)
        & cloudyarea(INS) )
     => tptpofobject(INS,f_tptpquantityfn_17(n_61)) ) )).

fof(ax3_3100,axiom,
    ( mtvisible(c_tptp_member3207_mt)
   => relationallinstance(c_tptpofobject,c_cloudyarea,f_tptpquantityfn_17(n_61)) )).

% Cyc Assertion #2175046:
fof(ax3_3101,axiom,(
    genlmt(c_tptp_member1028_mt,c_basekb) )).

% Cyc Assertion #197121:
fof(ax3_3102,axiom,(
    genlmt(c_fancifultaskprerequisitesmt,c_basekb) )).

% Cyc Assertion #258013:
fof(ax3_3103,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #793137:
fof(ax3_3104,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_musejhuedujournalscomputer_music_journalv026263dackpdf)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #332825:
fof(ax3_3105,axiom,(
    arg2isa(c_few_genquantrelnto,c_setorcollection) )).

fof(ax3_3106,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( few_genquantrelnto(ARG1,ARG2,ARG3)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #1204389:
fof(ax3_3107,axiom,(
    genlmt(c_hyp_needmicrotheory_145692,c_basekb) )).

% Cyc Assertion #342081:
fof(ax3_3108,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreennameforumcomforumsindexphpactprintclientprinterf2t7839)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1445587:
fof(ax3_3109,axiom,(
    genlmt(c_siprimt,c_hpkbvocabmt) )).

% Cyc Assertion #766376:
fof(ax3_3110,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbensonsworldcoukdvd_recommendsaspproduct7000000068255)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #329893:
fof(ax3_3111,axiom,(
    genlmt(c_sratemplateextractionontologymt,c_basekb) )).

% Cyc Assertion #536464:
fof(ax3_3112,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtalkingbookworldcomfeaturedbook1aspstoreurltalkingbookworldbookid193105620x)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1487765:
fof(ax3_3113,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwvwebsitescomweatherfl_weatherphp)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173598:
fof(ax3_3114,axiom,(
    genlmt(c_tptp_member666_mt,c_basekb) )).

% Cyc Assertion #1398380:
fof(ax3_3115,axiom,(
    genlmt(c_informationterminologymt,c_basekb) )).

% Cyc Assertion #1396039:
fof(ax3_3116,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaecjobbankcomceviewcontrollercmdviewfirmdetailid28638tm1111597638192)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #555560:
fof(ax3_3117,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_23),c_basekb) )).

% Cyc Assertion #411185:
fof(ax3_3118,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwhosoeverorgseedsletter73html)),c_translation_32),c_basekb) )).

% Cyc Assertion #1681325:
fof(ax3_3119,axiom,(
    genlmt(c_mtbeforehormuzblocking,c_basekb) )).

% Cyc Assertion #1166340:
fof(ax3_3120,axiom,(
    genlmt(c_nooescapearchitecturemt,c_worldcompletegeographymt) )).

% Cyc Assertion #2498059:
fof(ax3_3121,axiom,
    ( mtvisible(c_tptpgeo_member2_mt)
   => geographicalsubregions(c_georegion_l3_x25_y7,c_georegion_l4_x76_y21) )).

% Cyc Assertion #1135020:
fof(ax3_3122,axiom,(
    genlmt(c_alexipracticebabyatpoolimt,c_basekb) )).

% Cyc Assertion #1708610:
fof(ax3_3123,axiom,(
    genls(c_softwareparametervalueobject,c_individual) )).

fof(ax3_3124,axiom,(
    ! [OBJ] :
      ( softwareparametervalueobject(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #430933:
fof(ax3_3125,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(f_citynamedfn(s_puertobarrio,c_colombia)))
     => individual(OBJ) ) )).

fof(ax3_3126,axiom,(
    genls(f_residentfn(f_citynamedfn(s_puertobarrio,c_colombia)),c_individual) )).

fof(ax3_3127,axiom,(
    ! [OBJ] :
      ( residentfncitynamedfnpuertobarriocolombia(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #553770:
fof(ax3_3128,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrevolutionsfcomarticlehtmlid1574)),c_translation_31),c_basekb) )).

% Cyc Assertion #531559:
fof(ax3_3129,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_database_cia_world_factbook_2005),c_ldscgeneralcollectormt) )).

% Cyc Assertion #2463138:
fof(ax3_3130,axiom,(
    genlmt(c_tptpgeo_member1_mt,c_tptpgeo_spindleheadmt) )).

% Cyc Assertion #2172906:
fof(ax3_3131,axiom,(
    genlmt(c_tptp_member493_mt,c_basekb) )).

% Cyc Assertion #981023:
fof(ax3_3132,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtheanswerbankcouktravelquestion179542html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #332305:
fof(ax3_3133,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_protestantestate,c_partiallytangible,s_34024210_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_3134,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_protestantestate,c_partiallytangible,s_34024210_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_3135,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryprotestantestatepartiallytangible34024210_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1242586:
fof(ax3_3136,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_23),c_basekb) )).

% Cyc Assertion #790410:
fof(ax3_3137,axiom,(
    genlmt(c_scenariotestmt_5,c_basekb) )).

% Cyc Assertion #1069465:
fof(ax3_3138,axiom,(
    genlmt(c_familyanddogintreeimt,c_basekb) )).

% Cyc Assertion #2184910:
fof(ax3_3139,axiom,(
    genlmt(c_tptp_member3494_mt,c_basekb) )).

% Cyc Assertion #1514311:
fof(ax3_3140,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_binaryflixcommovieaspscopepid1208)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #378145:
fof(ax3_3141,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_masseventoftypefn(c_shootingagun))
     => individual(OBJ) ) )).

fof(ax3_3142,axiom,(
    genls(f_masseventoftypefn(c_shootingagun),c_individual) )).

fof(ax3_3143,axiom,(
    ! [OBJ] :
      ( masseventoftypefnshootingagun(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #309654:
fof(ax3_3144,axiom,(
    individual(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlibvirginiaedusmallexhibitsrave_reviewsbeyond_gwtwhtml)),c_translation_33)) )).

% Cyc Assertion #2184592:
fof(ax3_3145,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member3414_mt) )).

% Cyc Assertion #2181878:
fof(ax3_3146,axiom,(
    genlmt(c_tptp_member2736_mt,c_basekb) )).

% Cyc Assertion #226059:
fof(ax3_3147,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpvponlinecomnewsproarchivesarc7_2003html)),c_translation_25),c_basekb) )).

% Cyc Assertion #1115318:
fof(ax3_3148,axiom,(
    genls(c_alcohol_compound,c_inanimateobject) )).

fof(ax3_3149,axiom,(
    ! [OBJ] :
      ( alcohol_compound(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #1638890:
fof(ax3_3150,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwexxonsecretsorghtmlorgfactsheetphpid60)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #481367:
fof(ax3_3151,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjeanrenooffset0)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1154218:
fof(ax3_3152,axiom,(
    genlmt(c_terrorismparsingmt,c_basekb) )).

% Cyc Assertion #547838:
fof(ax3_3153,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmarxistsdemiddleastschoenmanprefhtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1107651:
fof(ax3_3154,axiom,(
    genlmt(c_humansociallifemt,c_culturegmt) )).

% Cyc Assertion #1746783:
fof(ax3_3155,axiom,(
    genlmt(c_calendarsvocabularymt,c_basekb) )).

% Cyc Assertion #974526:
fof(ax3_3156,axiom,(
    genls(c_defensivelyadvantageousterrain,c_geographicalregion) )).

fof(ax3_3157,axiom,(
    ! [OBJ] :
      ( defensivelyadvantageousterrain(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #835159:
fof(ax3_3158,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcccnanaimocamagnov0704htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #505725:
fof(ax3_3159,axiom,(
    genlmt(f_mtofbeliefsystemfn(c_wicca),c_basekb) )).

% Cyc Assertion #1718993:
fof(ax3_3160,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplewwaynelindacanadaright)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183838:
fof(ax3_3161,axiom,(
    genlmt(c_tptp_member3226_mt,c_basekb) )).

% Cyc Assertion #1193728:
fof(ax3_3162,axiom,
    ( mtvisible(c_cycnounlearnermt)
   => genls(c_cliche,c_aspatialinformationstore) )).

fof(ax3_3163,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_cycnounlearnermt)
        & cliche(OBJ) )
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1092215:
fof(ax3_3164,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcarlhiaasencom)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #558698:
fof(ax3_3165,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #732057:
fof(ax3_3166,axiom,(
    genlmt(f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1998))),c_currentworlddatacollectormt_nonhomocentric) )).

% Cyc Assertion #431829:
fof(ax3_3167,axiom,(
    genlmt(c_pornographyjargonmt,c_basekb) )).

% Cyc Assertion #1650239:
fof(ax3_3168,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrapturesolutioncombeechickintroqahtm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #156849:
fof(ax3_3169,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_carryagrenadeaboardanairplane,c_actiononobject,s_34146a84_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_3170,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_carryagrenadeaboardanairplane,c_actiononobject,s_34146a84_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_3171,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarycarryagrenadeaboardanairplaneactiononobject34146a84_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1531179:
fof(ax3_3172,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwetycomhrpmediasmithhtm)),c_translation_0),c_basekb) )).

% Cyc Assertion #657195:
fof(ax3_3173,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwclubmomcomjforumpostslist75142052page)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1381954:
fof(ax3_3174,axiom,(
    genlmt(c_obsoleterules_chemistrydomainmt,c_basekb) )).

% Cyc Assertion #2195928:
fof(ax3_3175,axiom,(
    ! [TERM] :
      ( isa(TERM,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent))
     => tptp_9_163(TERM,f_relationallexistsfn(TERM,c_tptp_9_163,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_28820)) ) )).

fof(ax3_3176,axiom,(
    relationallexists(c_tptp_9_163,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_28820) )).

% Cyc Assertion #410981:
fof(ax3_3177,axiom,(
    genlmt(f_contentmtfn(c_glassbox_annotation_ks),c_basekb) )).

% Cyc Assertion #364338:
fof(ax3_3178,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumslivingwithstylecomarchiveindexphpt_18522html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #197873:
fof(ax3_3179,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webamnestyorglibraryindexengasa160121999openofeng_2s3)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #921323:
fof(ax3_3180,axiom,(
    genlmt(c_clothinggvocabularymt,c_basekb) )).

% Cyc Assertion #1685438:
fof(ax3_3181,axiom,(
    genlmt(c_bcase_3235139646_1,c_basekb) )).

% Cyc Assertion #1011654:
fof(ax3_3182,axiom,(
    genls(c_gunshipunit_militaryspecialty,c_individual) )).

fof(ax3_3183,axiom,(
    ! [OBJ] :
      ( gunshipunit_militaryspecialty(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1221074:
fof(ax3_3184,axiom,(
    genlmt(c_cblcyclistemailaddresscheckingnodedefinitionmt,c_basekb) )).

% Cyc Assertion #2095399:
fof(ax3_3185,axiom,(
    genls(c_tptpcol_11_109062,c_tptpcol_10_109061) )).

fof(ax3_3186,axiom,(
    ! [OBJ] :
      ( tptpcol_11_109062(OBJ)
     => tptpcol_10_109061(OBJ) ) )).

% Cyc Assertion #912196:
fof(ax3_3187,axiom,(
    ! [OBJ] :
      ( collectionsubsetfngeographicalregionthesetofobjthereexistscountryandisacountrycountrygeographicallysubsumescountryobjintendscountrythereexistsgrowthandisagrowthgrowtheventobjectactedongrowtheconomyfnobj(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #347234:
fof(ax3_3188,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_southernappealblogspotcom2004_12_05_southernappeal_archivehtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #609862:
fof(ax3_3189,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_episkoposblogspotcomarchives2002_12_29_episkopos_archivehtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1118765:
fof(ax3_3190,axiom,(
    genlmt(c_snomedmappingmt,c_basekb) )).

% Cyc Assertion #1464253:
fof(ax3_3191,axiom,(
    genlmt(c_italianlexicalmt,c_basekb) )).

% Cyc Assertion #604779:
fof(ax3_3192,axiom,(
    skilledactivitytype(c_bustrip) )).

% Cyc Assertion #339795:
fof(ax3_3193,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwangelfirecomsc3redentormioitimothyhtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #437015:
fof(ax3_3194,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesettwodimensionalthingonedimensionalthing(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #1627662:
fof(ax3_3195,axiom,(
    genlmt(c_charliecriterion3_infoconcriterionmt,c_basekb) )).

% Cyc Assertion #621160:
fof(ax3_3196,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwteenreadscomreviews0679751130asp)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1052583:
fof(ax3_3197,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwarchivesnsnethistoryhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1160874:
fof(ax3_3198,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_lifsostypepadcomlulled_into_a_false_sense200509)),c_translation_1),c_basekb) )).

% Cyc Assertion #828843:
fof(ax3_3199,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_lifsostypepadcomlulled_into_a_false_sense200509another_one_makhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2177262:
fof(ax3_3200,axiom,(
    genlmt(c_tptp_member1582_mt,c_basekb) )).

% Cyc Assertion #2207952:
fof(ax3_3201,axiom,(
    shavingrazor_manual(c_theprototypicalshavingrazor_manual) )).

% Cyc Assertion #1778463:
fof(ax3_3202,axiom,(
    genls(c_wordnetsynsetimportstatus_readyforpossiblematching,c_thing) )).

fof(ax3_3203,axiom,(
    ! [OBJ] :
      ( wordnetsynsetimportstatus_readyforpossiblematching(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1082754:
fof(ax3_3204,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwartemisrecordscomexecutivebioaspxexecutivedannygoldberg)),c_translation_32),c_basekb) )).

% Cyc Assertion #685257:
fof(ax3_3205,axiom,(
    genlmt(c_coacontributorsmt,c_basekb) )).

% Cyc Assertion #2363198:
fof(ax3_3206,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3622_mt)
        & isa(INS,f_subcollectionofwithrelationfromtypefn(c_videoscreen,c_parts,c_cathoderaytube)) )
     => tptpofobject(INS,f_tptpquantityfn_2(n_108)) ) )).

fof(ax3_3207,axiom,
    ( mtvisible(c_tptp_member3622_mt)
   => relationallinstance(c_tptpofobject,f_subcollectionofwithrelationfromtypefn(c_videoscreen,c_parts,c_cathoderaytube),f_tptpquantityfn_2(n_108)) )).

% Cyc Assertion #867305:
fof(ax3_3208,axiom,(
    applicationcontext(c_mostwantedlistinterestingnessrulesmt) )).

% Cyc Assertion #1127981:
fof(ax3_3209,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1036429:
fof(ax3_3210,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprojocomcgi_binincludeplmoviesfilmscruciblehtm)),c_translation_1),c_basekb) )).

% Cyc Assertion #636640:
fof(ax3_3211,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #1456250:
fof(ax3_3212,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnndbcompeople243000025168)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172710:
fof(ax3_3213,axiom,(
    genlmt(c_tptp_member444_mt,c_basekb) )).

% Cyc Assertion #552984:
fof(ax3_3214,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediafabliscomindexphptechnical_university_of_munich)),c_translation_3),c_basekb) )).

% Cyc Assertion #1684074:
fof(ax3_3215,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #1352256:
fof(ax3_3216,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_29),c_basekb) )).

% Cyc Assertion #2174611:
fof(ax3_3217,axiom,(
    genlmt(c_tptp_member919_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1799582:
fof(ax3_3218,axiom,(
    genlmt(c_reasoningaboutgrammaticalagreementmt,c_basekb) )).

% Cyc Assertion #784902:
fof(ax3_3219,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newssurfwaxcomtvfilescybill_tvhtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #1620030:
fof(ax3_3220,axiom,(
    genls(c_eonoderawmeaningdefinedbutneedsdeeperke,c_aspatialinformationstore) )).

fof(ax3_3221,axiom,(
    ! [OBJ] :
      ( eonoderawmeaningdefinedbutneedsdeeperke(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1232835:
fof(ax3_3222,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycombenhecht)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2181654:
fof(ax3_3223,axiom,(
    genlmt(c_tptp_member2680_mt,c_basekb) )).

% Cyc Assertion #683234:
fof(ax3_3224,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_21),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1540655:
fof(ax3_3225,axiom,(
    genls(c_sourtaste,c_partiallytangible) )).

fof(ax3_3226,axiom,(
    ! [OBJ] :
      ( sourtaste(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #137629:
fof(ax3_3227,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrnscompages4action96html)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #612894:
fof(ax3_3228,axiom,(
    genls(c_geographicalregion,c_partiallytangible) )).

fof(ax3_3229,axiom,(
    ! [OBJ] :
      ( geographicalregion(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1662236:
fof(ax3_3230,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpvponlinecomnewsproarchivesarc7_2003html)),c_translation_31),c_basekb) )).

% Cyc Assertion #1154660:
fof(ax3_3231,axiom,(
    genls(c_cycinternaltask_researchcyc_project_the_74,c_individual) )).

fof(ax3_3232,axiom,(
    ! [OBJ] :
      ( cycinternaltask_researchcyc_project_the_74(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #735186:
fof(ax3_3233,axiom,(
    genls(c_supplies,c_artifact) )).

fof(ax3_3234,axiom,(
    ! [OBJ] :
      ( supplies(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1530127:
fof(ax3_3235,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_expressbus,c_partiallytangible,s_341a8500_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_3236,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_expressbus,c_partiallytangible,s_341a8500_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_3237,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryexpressbuspartiallytangible341a8500_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #660886:
fof(ax3_3238,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_die_thecube))
     => partiallytangible(OBJ) ) )).

fof(ax3_3239,axiom,(
    genls(f_groupfn(c_die_thecube),c_partiallytangible) )).

fof(ax3_3240,axiom,(
    ! [OBJ] :
      ( groupfndie_thecube(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1725492:
fof(ax3_3241,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_15),c_basekb) )).

% Cyc Assertion #177691:
fof(ax3_3242,axiom,(
    genls(c_cruisemissile_agm84hharpoon,c_individual) )).

fof(ax3_3243,axiom,(
    ! [OBJ] :
      ( cruisemissile_agm84hharpoon(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1372690:
fof(ax3_3244,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhealiohealthcombursitis_treatmenthtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #249142:
fof(ax3_3245,axiom,(
    genlmt(c_movementvocabularymt,c_basekb) )).

% Cyc Assertion #1863717:
fof(ax3_3246,axiom,(
    genls(c_tptpcol_4_16387,c_tptpcol_3_16386) )).

fof(ax3_3247,axiom,(
    ! [OBJ] :
      ( tptpcol_4_16387(OBJ)
     => tptpcol_3_16386(OBJ) ) )).

% Cyc Assertion #846631:
fof(ax3_3248,axiom,(
    genlmt(c_modality_inferencemt,c_basekb) )).

% Cyc Assertion #397639:
fof(ax3_3249,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dailyblabberivillagecomentertainmentarchives200511desperate_house_1html)),c_translation_29),c_basekb) )).

% Cyc Assertion #178621:
fof(ax3_3250,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlprooforgdevotions2005profitsharinghtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2174682:
fof(ax3_3251,axiom,(
    genlmt(c_tptp_member937_mt,c_basekb) )).

% Cyc Assertion #2094112:
fof(ax3_3252,axiom,(
    genls(c_tptpcol_6_108546,c_tptpcol_5_106498) )).

fof(ax3_3253,axiom,(
    ! [OBJ] :
      ( tptpcol_6_108546(OBJ)
     => tptpcol_5_106498(OBJ) ) )).

% Cyc Assertion #210215:
fof(ax3_3254,axiom,(
    genlmt(c_observationalastronomyvocabularymt,c_basekb) )).

% Cyc Assertion #2179570:
fof(ax3_3255,axiom,(
    genlmt(c_tptp_member2159_mt,c_basekb) )).

% Cyc Assertion #983006:
fof(ax3_3256,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_profile_rifaat_al_assad),c_ldscgeneralcollectormt) )).

% Cyc Assertion #2179472:
fof(ax3_3257,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member2134_mt) )).

% Cyc Assertion #390754:
fof(ax3_3258,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpalestinemonitororgother20updateswillful_killing_israel_palestinehtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #552882:
fof(ax3_3259,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_tastefn(f_fruitfn(c_orangetree)))
     => partiallytangible(OBJ) ) )).

fof(ax3_3260,axiom,(
    genls(f_tastefn(f_fruitfn(c_orangetree)),c_partiallytangible) )).

fof(ax3_3261,axiom,(
    ! [OBJ] :
      ( tastefnfruitfnorangetree(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1517470:
fof(ax3_3262,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic2418494viewnew)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2491583:
fof(ax3_3263,axiom,
    ( mtvisible(c_tptpgeo_member7_mt)
   => geographicalsubregions(c_georegion_l2_x5_y8,c_georegion_l3_x15_y25) )).

% Cyc Assertion #2171826:
fof(ax3_3264,axiom,(
    genlmt(c_tptp_member223_mt,c_basekb) )).

% Cyc Assertion #632653:
fof(ax3_3265,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1162413:
fof(ax3_3266,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #311521:
fof(ax3_3267,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_23),c_basekb) )).

% Cyc Assertion #259478:
fof(ax3_3268,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mysiteverizonnetsvogl011deadnowhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #934179:
fof(ax3_3269,axiom,(
    genlmt(c_ciaworldfactbook1994mt,c_basekb) )).

% Cyc Assertion #164013:
fof(ax3_3270,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwradfordreviewscomcgi_binrviewcgirmmode2typereviewnameamistad)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1529225:
fof(ax3_3271,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwiceplantorg200107)),c_translation_33),c_basekb) )).

% Cyc Assertion #2053158:
fof(ax3_3272,axiom,(
    genls(c_tptpcol_9_92165,c_tptpcol_8_92164) )).

fof(ax3_3273,axiom,(
    ! [OBJ] :
      ( tptpcol_9_92165(OBJ)
     => tptpcol_8_92164(OBJ) ) )).

% Cyc Assertion #799458:
fof(ax3_3274,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkaraokeinfocoukforumforum_postsasptid887tpn2)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #231308:
fof(ax3_3275,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstarpulsecomnewsxmlsrvrssphpblog2)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #239025:
fof(ax3_3276,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomdr_b_goldsteinrabbi_meir_kahanehtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #397575:
fof(ax3_3277,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_city))
     => partiallytangible(OBJ) ) )).

fof(ax3_3278,axiom,(
    genls(f_groupfn(c_city),c_partiallytangible) )).

fof(ax3_3279,axiom,(
    ! [OBJ] :
      ( groupfncity(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2172918:
fof(ax3_3280,axiom,(
    genlmt(c_tptp_member496_mt,c_basekb) )).

% Cyc Assertion #726177:
fof(ax3_3281,axiom,(
    genlmt(c_socreport_cia_20030425_reportcontent,c_basekb) )).

% Cyc Assertion #1176171:
fof(ax3_3282,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordhitsoffset0)),c_translation_29),c_basekb) )).

% Cyc Assertion #826724:
fof(ax3_3283,axiom,(
    genlmt(c_conceptualunderspecificationmt,c_basekb) )).

% Cyc Assertion #1229600:
fof(ax3_3284,axiom,(
    genlmt(c_pq102mt,c_basekb) )).

% Cyc Assertion #618737:
fof(ax3_3285,axiom,(
    genls(c_geography_topic,c_thing) )).

fof(ax3_3286,axiom,(
    ! [OBJ] :
      ( geography_topic(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1704753:
fof(ax3_3287,axiom,(
    genls(c_anpps_5_sensor,c_partiallytangible) )).

fof(ax3_3288,axiom,(
    ! [OBJ] :
      ( anpps_5_sensor(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2426500:
fof(ax3_3289,axiom,
    ( mtvisible(c_tptp_member1698_mt)
   => shavingrazor_manual(c_tptpshavingrazor_manual_18) )).

% Cyc Assertion #1240844:
fof(ax3_3290,axiom,(
    genlmt(c_dontburncandles,c_basekb) )).

% Cyc Assertion #159844:
fof(ax3_3291,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrediffcomnews1999apr30keralhtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1061581:
fof(ax3_3292,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_12),c_basekb) )).

% Cyc Assertion #2181558:
fof(ax3_3293,axiom,(
    genlmt(c_tptp_member2656_mt,c_basekb) )).

% Cyc Assertion #1461136:
fof(ax3_3294,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhgtvcomhgtvrm_restoration_homes_areasarticle01797hgtv_3787_137528800html)),c_translation_31),c_basekb) )).

% Cyc Assertion #899631:
fof(ax3_3295,axiom,(
    genlmt(c_l2rlinkagereificationtemplatemt,c_basekb) )).

% Cyc Assertion #2261475:
fof(ax3_3296,axiom,
    ( mtvisible(c_tptp_member2191_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_14) )).

% Cyc Assertion #219401:
fof(ax3_3297,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(c_partiallytangible,c_segmentofchain_individual,f_somefn(c_segmentedcordlikeobject)))
     => partiallytangible(OBJ) ) )).

fof(ax3_3298,axiom,(
    genls(f_subcollectionofwithrelationfromfn(c_partiallytangible,c_segmentofchain_individual,f_somefn(c_segmentedcordlikeobject)),c_partiallytangible) )).

fof(ax3_3299,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnpartiallytangiblesegmentofchain_individualsomefnsegmentedcordlikeobject(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1428703:
fof(ax3_3300,axiom,(
    genlmt(c_pq16mt,c_basekb) )).

% Cyc Assertion #476401:
fof(ax3_3301,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkentuckycommldheraldleadersports6546184htm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #378231:
fof(ax3_3302,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsdvdfilecomarchiveindexphpt_16217html)),c_translation_32),c_basekb) )).

% Cyc Assertion #1214546:
fof(ax3_3303,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhrworgreports2001kosovoundword_07htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2182126:
fof(ax3_3304,axiom,(
    genlmt(c_tptp_member2798_mt,c_basekb) )).

% Cyc Assertion #1402897:
fof(ax3_3305,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtaorminafilmfestit2003englishawardschedaaspid9)),c_translation_32),c_basekb) )).

% Cyc Assertion #709246:
fof(ax3_3306,axiom,(
    genlmt(c_commercialbuyingmt,c_basekb) )).

% Cyc Assertion #2174362:
fof(ax3_3307,axiom,(
    genlmt(c_tptp_member857_mt,c_basekb) )).

% Cyc Assertion #2175068:
fof(ax3_3308,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member1033_mt) )).

% Cyc Assertion #2178758:
fof(ax3_3309,axiom,(
    genlmt(c_tptp_member1956_mt,c_basekb) )).

% Cyc Assertion #2182934:
fof(ax3_3310,axiom,(
    genlmt(c_tptp_member3000_mt,c_basekb) )).

% Cyc Assertion #656471:
fof(ax3_3311,axiom,
    ( mtvisible(c_analogicalreasoningmt)
   => arg2isa(c_correspondencefortargetitem,c_cyclexpression) )).

fof(ax3_3312,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( ( mtvisible(c_analogicalreasoningmt)
        & correspondencefortargetitem(ARG1,ARG2,ARG3) )
     => cyclexpression(ARG2) ) )).

% Cyc Assertion #2172398:
fof(ax3_3313,axiom,(
    genlmt(c_tptp_member366_mt,c_basekb) )).

% Cyc Assertion #415361:
fof(ax3_3314,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_29),c_basekb) )).

% Cyc Assertion #360739:
fof(ax3_3315,axiom,(
    genls(c_pzm_trenchdigger,c_artifact) )).

fof(ax3_3316,axiom,(
    ! [OBJ] :
      ( pzm_trenchdigger(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #204478:
fof(ax3_3317,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomresearchtrianglelab4191millermillershtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #790954:
fof(ax3_3318,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbible_historycomisbettimothy)),c_translation_32),c_basekb) )).

% Cyc Assertion #1371969:
fof(ax3_3319,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dodgsonucsdedulaselsal1973_1980html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2171794:
fof(ax3_3320,axiom,(
    genlmt(c_tptp_member215_mt,c_basekb) )).

% Cyc Assertion #1713868:
fof(ax3_3321,axiom,(
    genls(c_armoredreconcarrier_sensor_lav,c_individual) )).

fof(ax3_3322,axiom,(
    ! [OBJ] :
      ( armoredreconcarrier_sensor_lav(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1294231:
fof(ax3_3323,axiom,(
    individual(c_gachsaranoilfield) )).

% Cyc Assertion #1791012:
fof(ax3_3324,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwentertainment_newsorgbreaking3857er_doc_finds_new_lovehtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #860861:
fof(ax3_3325,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_artsedgekennedy_centerorgcontent3498)),c_translation_7),c_basekb) )).

% Cyc Assertion #2298870:
fof(ax3_3326,axiom,
    ( mtvisible(c_cyclistsmt)
   => strategictarget(c_tptpstrategictarget_9121) )).

% Cyc Assertion #1548341:
fof(ax3_3327,axiom,(
    genlmt(c_textualinferencecontentmodelcreationtemplatemt,c_basekb) )).

% Cyc Assertion #2180446:
fof(ax3_3328,axiom,(
    genlmt(c_tptp_member2378_mt,c_basekb) )).

% Cyc Assertion #1219857:
fof(ax3_3329,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeopleaandrewsdonaldftppypeopleaandrewsdonaldcanadaright)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2185662:
fof(ax3_3330,axiom,(
    genlmt(c_tptp_member3682_mt,c_basekb) )).

% Cyc Assertion #2477247:
fof(ax3_3331,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x1_y9) )).

% Cyc Assertion #715784:
fof(ax3_3332,axiom,(
    webgatheredgafmicrotheory(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsimonsayscomtitles0684810948authorhtml)),c_translation_3)) )).

% Cyc Assertion #2184886:
fof(ax3_3333,axiom,(
    genlmt(c_tptp_member3488_mt,c_basekb) )).

% Cyc Assertion #290319:
fof(ax3_3334,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwindependent_bangladeshcomnewsjul0101072005mghtm)),c_translation_29),c_basekb) )).

% Cyc Assertion #1538387:
fof(ax3_3335,axiom,(
    genlmt(c_butler_fastbusiness_mt,c_cyclistsmt) )).

% Cyc Assertion #2182912:
fof(ax3_3336,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member2994_mt) )).

% Cyc Assertion #2181918:
fof(ax3_3337,axiom,(
    genlmt(c_tptp_member2746_mt,c_basekb) )).

% Cyc Assertion #418343:
fof(ax3_3338,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrnscompages4action96html)),c_translation_19),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1291530:
fof(ax3_3339,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archiveaudioreviewcom050ef87e1aphp)),c_translation_0),c_basekb) )).

% Cyc Assertion #1618384:
fof(ax3_3340,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_etdlibfsueduthesesavailableetd_11152004_195710unrestricted02_las_mainpdf)),c_translation_32),c_basekb) )).

% Cyc Assertion #1614447:
fof(ax3_3341,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_s6invisionfreecom80s_cartoonsindexphpshowtopic2854viewgetnewpost)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184262:
fof(ax3_3342,axiom,(
    genlmt(c_tptp_member3332_mt,c_basekb) )).

% Cyc Assertion #2180678:
fof(ax3_3343,axiom,(
    genlmt(c_tptp_member2436_mt,c_basekb) )).

% Cyc Assertion #1545258:
fof(ax3_3344,axiom,(
    genlmt(c_ethnicgroupsmt,c_ethnicgroupsvocabularymt) )).

% Cyc Assertion #1006364:
fof(ax3_3345,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwebazillionscomdvds_sling20bladehtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1448658:
fof(ax3_3346,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_accessoryfn_artifact(c_nintendo64_theproduct))
     => artifact(OBJ) ) )).

fof(ax3_3347,axiom,(
    genls(f_accessoryfn_artifact(c_nintendo64_theproduct),c_artifact) )).

fof(ax3_3348,axiom,(
    ! [OBJ] :
      ( accessoryfn_artifactnintendo64_theproduct(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #951515:
fof(ax3_3349,axiom,(
    genlmt(c_girlanddadswingingimt,c_basekb) )).

% Cyc Assertion #899226:
fof(ax3_3350,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_spleenvillecomlilith33blogmt_commentscgientry_id7948)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #989643:
fof(ax3_3351,axiom,(
    genlmt(c_worldpoliticalgeographydatavocabularymt,c_basekb) )).

% Cyc Assertion #2178488:
fof(ax3_3352,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member1888_mt) )).

% Cyc Assertion #2179494:
fof(ax3_3353,axiom,(
    genlmt(c_tptp_member2140_mt,c_basekb) )).

% Cyc Assertion #332763:
fof(ax3_3354,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcommongroundcommonsenseorgforumsindexphpshowtopic10194)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #894468:
fof(ax3_3355,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom200508on_writinghtml)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #389500:
fof(ax3_3356,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_homegrown_terrorists__how_a_hezbollah_cell_made_millions_in_sleepy_charlotte_nc),c_basekb) )).

% Cyc Assertion #2180150:
fof(ax3_3357,axiom,(
    genlmt(c_tptp_member2304_mt,c_basekb) )).

% Cyc Assertion #1504578:
fof(ax3_3358,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsmeccorgsage_a_n_fsq_7htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1636132:
fof(ax3_3359,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordmoonstruckoffset0)),c_translation_32),c_basekb) )).

% Cyc Assertion #1226756:
fof(ax3_3360,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordkryptonoffset0)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176046:
fof(ax3_3361,axiom,(
    genlmt(c_tptp_member1278_mt,c_basekb) )).

% Cyc Assertion #1890041:
fof(ax3_3362,axiom,(
    genls(c_tptpcol_12_26919,c_tptpcol_11_26887) )).

fof(ax3_3363,axiom,(
    ! [OBJ] :
      ( tptpcol_12_26919(OBJ)
     => tptpcol_11_26887(OBJ) ) )).

% Cyc Assertion #1633805:
fof(ax3_3364,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreenselectcoukvisitoreditorial562html)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #686189:
fof(ax3_3365,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_cdi_terrorism_project__in_the_spotlight__asbat_al_ansar_band_of_partisans),c_ldscgeneralcollectormt) )).

% Cyc Assertion #2179291:
fof(ax3_3366,axiom,(
    genlmt(c_tptp_member2089_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #801091:
fof(ax3_3367,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetunderwaterlocationgap_topographical(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1443732:
fof(ax3_3368,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprojocomcgi_binincludeplmoviesfilmscruciblehtm)),c_translation_15),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1663401:
fof(ax3_3369,axiom,
    ( mtvisible(c_englishmt)
   => prettystring(f_subcollectionofwithrelationfromtypefn(c_terrorist,c_hasmembers,c_terroristgroup),s_terroristthatisamemberofagroups) )).

% Cyc Assertion #1172673:
fof(ax3_3370,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetgravellysoilregionrockysoilregion(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1803224:
fof(ax3_3371,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreadiocomarchives030205bbroadway5html)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183130:
fof(ax3_3372,axiom,(
    genlmt(c_tptp_member3049_mt,c_basekb) )).

% Cyc Assertion #1375921:
fof(ax3_3373,axiom,(
    genlmt(c_wordnet2_0hypothesesmt,c_basekb) )).

% Cyc Assertion #733781:
fof(ax3_3374,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_14),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1365162:
fof(ax3_3375,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrockiesnetspiritsermonsa_or32_jsphp)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #611464:
fof(ax3_3376,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_17),c_basekb) )).

% Cyc Assertion #1058451:
fof(ax3_3377,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_28),c_basekb) )).

% Cyc Assertion #1780976:
fof(ax3_3378,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpvponlinecomnewsproarchivesarc7_2003html)),c_translation_28),c_basekb) )).

% Cyc Assertion #682392:
fof(ax3_3379,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinq7netent2003jun15ent_5_1htm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1012972:
fof(ax3_3380,axiom,(
    genlmt(c_telcogvocabularymt,c_basekb) )).

% Cyc Assertion #2155278:
fof(ax3_3381,axiom,(
    genlinverse(c_tptptypes_8_692,c_tptptypes_7_691) )).

fof(ax3_3382,axiom,(
    ! [ARG1,ARG2] :
      ( tptptypes_8_692(ARG1,ARG2)
     => tptptypes_7_691(ARG2,ARG1) ) )).

% Cyc Assertion #679832:
fof(ax3_3383,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #410697:
fof(ax3_3384,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #2173078:
fof(ax3_3385,axiom,(
    genlmt(c_tptp_member536_mt,c_basekb) )).

% Cyc Assertion #1017343:
fof(ax3_3386,axiom,(
    arg2isa(c_potentialdutyofagent,c_setorcollection) )).

fof(ax3_3387,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( potentialdutyofagent(ARG1,ARG2,ARG3)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #2095635:
fof(ax3_3388,axiom,(
    genls(c_tptpcol_12_109157,c_tptpcol_11_109125) )).

fof(ax3_3389,axiom,(
    ! [OBJ] :
      ( tptpcol_12_109157(OBJ)
     => tptpcol_11_109125(OBJ) ) )).

% Cyc Assertion #330885:
fof(ax3_3390,axiom,(
    genlmt(c_weatherprocessmt,c_basekb) )).

% Cyc Assertion #1877931:
fof(ax3_3391,axiom,(
    genls(c_tptpcol_15_22076,c_tptpcol_14_22072) )).

fof(ax3_3392,axiom,(
    ! [OBJ] :
      ( tptpcol_15_22076(OBJ)
     => tptpcol_14_22072(OBJ) ) )).

% Cyc Assertion #1889960:
fof(ax3_3393,axiom,(
    genls(c_tptpcol_10_26886,c_tptpcol_9_26885) )).

fof(ax3_3394,axiom,(
    ! [OBJ] :
      ( tptpcol_10_26886(OBJ)
     => tptpcol_9_26885(OBJ) ) )).

% Cyc Assertion #1690190:
fof(ax3_3395,axiom,(
    genlmt(c_communicationssupportmt,c_basekb) )).

% Cyc Assertion #1426301:
fof(ax3_3396,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_33),c_basekb) )).

% Cyc Assertion #1149674:
fof(ax3_3397,axiom,(
    genls(c_stable_structure,c_partiallytangible) )).

fof(ax3_3398,axiom,(
    ! [OBJ] :
      ( stable_structure(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #502049:
fof(ax3_3399,axiom,(
    genls(c_hn1,c_partiallytangible) )).

fof(ax3_3400,axiom,(
    ! [OBJ] :
      ( hn1(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #855033:
fof(ax3_3401,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwiconsoffrightcomjt_12_05htm)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #325852:
fof(ax3_3402,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetlightrainareamoderatebreezearea(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #736815:
fof(ax3_3403,axiom,(
    genls(c_beachridge,c_partiallytangible) )).

fof(ax3_3404,axiom,(
    ! [OBJ] :
      ( beachridge(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #799880:
fof(ax3_3405,axiom,(
    genls(c_gaseous_stateofmatter,c_partiallytangible) )).

fof(ax3_3406,axiom,(
    ! [OBJ] :
      ( gaseous_stateofmatter(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #194354:
fof(ax3_3407,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_dumb,c_thing,s_341f18e2_f4ed_11d9_9bea_0002b3a85b0b))
     => thing(OBJ) ) )).

fof(ax3_3408,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_dumb,c_thing,s_341f18e2_f4ed_11d9_9bea_0002b3a85b0b),c_thing) )).

fof(ax3_3409,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarydumbthing341f18e2_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #578791:
fof(ax3_3410,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_reviewsauthorstorecom200504an_anonymous_auhtml)),c_translation_8),c_basekb) )).

% Cyc Assertion #2174626:
fof(ax3_3411,axiom,(
    genlmt(c_tptp_member923_mt,c_basekb) )).

% Cyc Assertion #385313:
fof(ax3_3412,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmccchurchorgmncstatement20of20call20to20be20the20next20moderator20of20ufmccdoc)),c_translation_2),c_basekb) )).

% Cyc Assertion #358892:
fof(ax3_3413,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwiueduusersmfwcwiugreatgatsbyhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1573498:
fof(ax3_3414,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_timeline__iran_nuclear_crisis),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #263116:
fof(ax3_3415,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_kurdish_reawakening_in_syria_the),c_ldscgeneralcollectormt) )).

% Cyc Assertion #2172130:
fof(ax3_3416,axiom,(
    genlmt(c_tptp_member299_mt,c_basekb) )).

% Cyc Assertion #800940:
fof(ax3_3417,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwagabuscouktitusnoteshtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #2180322:
fof(ax3_3418,axiom,(
    genlmt(c_tptp_member2347_mt,c_basekb) )).

% Cyc Assertion #610659:
fof(ax3_3419,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjoblocomatfirstsighthtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #912984:
fof(ax3_3420,axiom,(
    genls(c_witchbroomstick,c_individual) )).

fof(ax3_3421,axiom,(
    ! [OBJ] :
      ( witchbroomstick(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1510188:
fof(ax3_3422,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnytimescombooksfirstssteyn_broadwayhtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2180214:
fof(ax3_3423,axiom,(
    genlmt(c_tptp_member2320_mt,c_basekb) )).

% Cyc Assertion #2182870:
fof(ax3_3424,axiom,(
    genlmt(c_tptp_member2984_mt,c_basekb) )).

% Cyc Assertion #1098595:
fof(ax3_3425,axiom,(
    genls(c_wetbacillusglobigii,c_partiallytangible) )).

fof(ax3_3426,axiom,(
    ! [OBJ] :
      ( wetbacillusglobigii(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #790335:
fof(ax3_3427,axiom,(
    genlmt(c_calendarsvocabularymt,c_generictemporalmt) )).

% Cyc Assertion #477114:
fof(ax3_3428,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomscrewball20comedy20film)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2186366:
fof(ax3_3429,axiom,(
    genlmt(c_tptp_member3858_mt,c_basekb) )).

% Cyc Assertion #522289:
fof(ax3_3430,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_27),c_basekb) )).

% Cyc Assertion #1597332:
fof(ax3_3431,axiom,(
    genls(c_persontypebyclothingstate,c_collection) )).

fof(ax3_3432,axiom,(
    ! [OBJ] :
      ( persontypebyclothingstate(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #2183690:
fof(ax3_3433,axiom,(
    genlmt(c_tptp_member3189_mt,c_basekb) )).

% Cyc Assertion #531668:
fof(ax3_3434,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgiabgovtnzdefaultaspchannelmemberspagemembers)),c_translation_1),c_basekb) )).

% Cyc Assertion #1694192:
fof(ax3_3435,axiom,(
    genls(c_flatregion,c_geographicalregion) )).

fof(ax3_3436,axiom,(
    ! [OBJ] :
      ( flatregion(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #370497:
fof(ax3_3437,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsusmsorgshowthreadphps7f6b0d46156934cb7644d098446d30bfthreadid2363)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1763829:
fof(ax3_3438,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_detonateanexplosivedeviceatjerusalemsatarotairport,c_actiononobject,s_341fb522_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_3439,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_detonateanexplosivedeviceatjerusalemsatarotairport,c_actiononobject,s_341fb522_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_3440,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarydetonateanexplosivedeviceatjerusalemsatarotairportactiononobject341fb522_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1213386:
fof(ax3_3441,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwxcapewithuscomsitebrocherspropertyasppropid2027site513cix)),c_translation_33),c_basekb) )).

% Cyc Assertion #2510836:
fof(ax3_3442,axiom,
    ( mtvisible(c_tptpgeo_member7_mt)
   => borderson(c_georegion_l4_x27_y64,c_georegion_l4_x28_y64) )).

% Cyc Assertion #991395:
fof(ax3_3443,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinterstudyorgirelandqueensuniversityintroqueenshtml)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #958256:
fof(ax3_3444,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordmarymcdonnelloffset0)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1459076:
fof(ax3_3445,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgreens_inorgarticle229phpsessid3641f5f711b0afdf34ae8268e87866d3)),c_translation_2),c_basekb) )).

% Cyc Assertion #2463143:
fof(ax3_3446,axiom,(
    genlmt(c_tptpgeo_spindlecollectormt,c_tptpgeo_member2_mt) )).

% Cyc Assertion #386235:
fof(ax3_3447,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcolumbusalivecom200020000406music1html)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1536878:
fof(ax3_3448,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwalbanynetlauraleearqhtm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1024746:
fof(ax3_3449,axiom,(
    genlmt(f_lexicalmtforlanguagefn(c_finnishlanguage),c_basekb) )).

% Cyc Assertion #1075901:
fof(ax3_3450,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviepoopshootcomnewsaug027html)),c_translation_0),c_basekb) )).

% Cyc Assertion #2185786:
fof(ax3_3451,axiom,(
    genlmt(c_tptp_member3713_mt,c_basekb) )).

% Cyc Assertion #879464:
fof(ax3_3452,axiom,(
    ! [OBJ] :
      ( collectionunionfntheseteventartifact(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #946061:
fof(ax3_3453,axiom,(
    genlmt(c_massmediadatamt,c_massmediamt) )).

% Cyc Assertion #868621:
fof(ax3_3454,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_memberstripodcomindygalfordtriviahtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #682933:
fof(ax3_3455,axiom,
    ( mtvisible(c_rhetoricalstructuremt)
   => arg2isa(c_background_rst,c_linguisticobject) )).

fof(ax3_3456,axiom,(
    ! [ARG1,ARG2] :
      ( ( mtvisible(c_rhetoricalstructuremt)
        & background_rst(ARG1,ARG2) )
     => linguisticobject(ARG2) ) )).

% Cyc Assertion #2179823:
fof(ax3_3457,axiom,(
    genlmt(c_tptp_member2222_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1628514:
fof(ax3_3458,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlittlegreenfootballscomweblogentry8973)),c_translation_32),c_basekb) )).

% Cyc Assertion #1465611:
fof(ax3_3459,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(c_personwithoccupation,c_performsinstancesaspartofjob,f_subcollectionofwithrelationtotypefn(c_presiding,c_objectcontrolled,c_legislativeorganization)))
     => individual(OBJ) ) )).

fof(ax3_3460,axiom,(
    genls(f_subcollectionofwithrelationfromfn(c_personwithoccupation,c_performsinstancesaspartofjob,f_subcollectionofwithrelationtotypefn(c_presiding,c_objectcontrolled,c_legislativeorganization)),c_individual) )).

fof(ax3_3461,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnpersonwithoccupationperformsinstancesaspartofjobsubcollectionofwithrelationtotypefnpresidingobjectcontrolledlegislativeorganization(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2184307:
fof(ax3_3462,axiom,(
    genlmt(c_tptp_member3343_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #281154:
fof(ax3_3463,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_wwwciraitinfogeninfogene06htm))) )).

% Cyc Assertion #630589:
fof(ax3_3464,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(f_urlfn(s_http_enwikipediaorgwikiuser_talk_meltbanana)))) )).

% Cyc Assertion #1162203:
fof(ax3_3465,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikibeloved_novel)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1677114:
fof(ax3_3466,axiom,(
    genls(c_sensitivebutunclassified,c_aspatialinformationstore) )).

fof(ax3_3467,axiom,(
    ! [OBJ] :
      ( sensitivebutunclassified(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #2171350:
fof(ax3_3468,axiom,(
    genlmt(c_tptp_member104_mt,c_basekb) )).

% Cyc Assertion #1163208:
fof(ax3_3469,axiom,(
    genlmt(c_ldscexperimentaltermsmt,c_ldscgeneralcollectormt) )).

% Cyc Assertion #1195266:
fof(ax3_3470,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_joyfulmusictripodcompage4html)),c_translation_25),c_basekb) )).

% Cyc Assertion #696129:
fof(ax3_3471,axiom,(
    genlmt(c_naturalgeographymt,c_basekb) )).

% Cyc Assertion #1594446:
fof(ax3_3472,axiom,(
    genlmt(c_timezonemt,c_basekb) )).

% Cyc Assertion #936020:
fof(ax3_3473,axiom,(
    genls(c_threateningtodokilling_biologicalsubeventscombustionprocess,c_individual) )).

fof(ax3_3474,axiom,(
    ! [OBJ] :
      ( threateningtodokilling_biologicalsubeventscombustionprocess(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1286085:
fof(ax3_3475,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfreerepubliccomfocusf_news1531919posts)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1104894:
fof(ax3_3476,axiom,(
    genls(c_pointyended,c_partiallytangible) )).

fof(ax3_3477,axiom,(
    ! [OBJ] :
      ( pointyended(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2175742:
fof(ax3_3478,axiom,(
    genlmt(c_tptp_member1202_mt,c_basekb) )).

% Cyc Assertion #1474727:
fof(ax3_3479,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommaahtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #626388:
fof(ax3_3480,axiom,(
    genlmt(f_presuppositionsmtofpcwfn(c_exemplarlearnbyreadingdocument),c_logicaltruthmt) )).

% Cyc Assertion #1331206:
fof(ax3_3481,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmatthewmcgeeorgpaultimehtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1085392:
fof(ax3_3482,axiom,
    ( mtvisible(c_humanactivitiesmt)
   => typicalhumanactivitytype_atleastonce(c_kneading) )).

% Cyc Assertion #367371:
fof(ax3_3483,axiom,(
    wordnetsynset(f_wordnetsynsetreifiedfn(n_862965)) )).

% Cyc Assertion #2073077:
fof(ax3_3484,axiom,(
    firstordercollection(c_tptpcol_12_100134) )).

% Cyc Assertion #1135250:
fof(ax3_3485,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwterrorismcentralcomlibrarybiographiesbioskahanekahanelisthtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #916308:
fof(ax3_3486,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleadingauthoritiescomtalentaallen_debbieallen_debbiedoc)),c_translation_26),c_basekb) )).

% Cyc Assertion #632933:
fof(ax3_3487,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfirestreamnetviewtopicphpt14262side7998082faab8a2c158e4622e3556a55)),c_translation_33),c_basekb) )).

% Cyc Assertion #1203527:
fof(ax3_3488,axiom,(
    genlmt(c_commonsensetestmt,c_basekb) )).

% Cyc Assertion #1023240:
fof(ax3_3489,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcosmicpenguincomhhzprefhtm)),c_translation_0),c_basekb) )).

% Cyc Assertion #1652662:
fof(ax3_3490,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcanoecajammoviesartistsppreston_kellyhtml)),c_translation_22),c_basekb) )).

% Cyc Assertion #1123144:
fof(ax3_3491,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_joyfulmusictripodcompage4html)),c_translation_27),c_basekb) )).

% Cyc Assertion #555679:
fof(ax3_3492,axiom,(
    genlmt(c_affectvocabularymt,c_basekb) )).

% Cyc Assertion #574823:
fof(ax3_3493,axiom,(
    genlmt(f_modelmtbyuserandtaskfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),c_researchfailediranrussianucleardeal),c_basekb) )).

% Cyc Assertion #2512507:
fof(ax3_3494,axiom,
    ( mtvisible(c_tptpgeo_member1_mt)
   => borderson(c_georegion_l4_x38_y24,c_georegion_l4_x39_y24) )).

% Cyc Assertion #1315386:
fof(ax3_3495,axiom,(
    genls(c_commonsensetest_probabilityreasoning,c_individual) )).

fof(ax3_3496,axiom,(
    ! [OBJ] :
      ( commonsensetest_probabilityreasoning(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1643673:
fof(ax3_3497,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_eslaboutcomlibraryvocabularyblwordgroups_places_communities_ehtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1215495:
fof(ax3_3498,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoldpathscomarchivesouthernpaul1901cor2html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1727414:
fof(ax3_3499,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfloridaviewcomcalendarcommunitiesleontallahasseeplainhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #535657:
fof(ax3_3500,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcrimelibrarycomterrorists_spiesterroristselsayid_nosair8htmlsect7)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2003817:
fof(ax3_3501,axiom,(
    firstordercollection(c_tptpcol_15_72431) )).

% Cyc Assertion #2182170:
fof(ax3_3502,axiom,(
    genlmt(c_tptp_member2809_mt,c_basekb) )).

% Cyc Assertion #774674:
fof(ax3_3503,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_femaleanimal,c_aestheticqualityofthing,f_highamountfn(c_beauty)))
     => thing(OBJ) ) )).

fof(ax3_3504,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_femaleanimal,c_aestheticqualityofthing,f_highamountfn(c_beauty)),c_thing) )).

fof(ax3_3505,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnfemaleanimalaestheticqualityofthinghighamountfnbeauty(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1738740:
fof(ax3_3506,axiom,(
    genlmt(c_nysdohinfectioncharacteristicstablemt,c_basekb) )).

% Cyc Assertion #677282:
fof(ax3_3507,axiom,(
    genls(c_sagemanindividual,c_thing) )).

fof(ax3_3508,axiom,(
    ! [OBJ] :
      ( sagemanindividual(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2173326:
fof(ax3_3509,axiom,(
    genlmt(c_tptp_member598_mt,c_basekb) )).

% Cyc Assertion #1740953:
fof(ax3_3510,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreenselectcoukvisitoreditorial562html)),c_translation_14),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1341861:
fof(ax3_3511,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_peoplesunyiteduharrellbillyjackbelovedhtm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1142697:
fof(ax3_3512,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_westernamericanablogspotcom200511tackling_new_frontier_in_filmhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1753472:
fof(ax3_3513,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwrightedugordonweltylundin_93htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1242111:
fof(ax3_3514,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(c_personwithoccupation,c_performsinstancesaspartofjob,c_lawenforcementactivity))
     => partiallytangible(OBJ) ) )).

fof(ax3_3515,axiom,(
    genls(f_subcollectionofwithrelationfromfn(c_personwithoccupation,c_performsinstancesaspartofjob,c_lawenforcementactivity),c_partiallytangible) )).

fof(ax3_3516,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnpersonwithoccupationperformsinstancesaspartofjoblawenforcementactivity(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1317758:
fof(ax3_3517,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwugaeducolumns100796info1html)),c_translation_29),c_basekb) )).

% Cyc Assertion #1163794:
fof(ax3_3518,axiom,(
    arg2isa(f_correspondinggenquantfn(c_many_nlattr),c_setorcollection) )).

% Cyc Assertion #1764200:
fof(ax3_3519,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwacousticguitarcomissuesag94coverstoryshtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1637189:
fof(ax3_3520,axiom,(
    genlmt(c_mtforcp_q22,c_basekb) )).

% Cyc Assertion #2171758:
fof(ax3_3521,axiom,(
    genlmt(c_tptp_member206_mt,c_basekb) )).

% Cyc Assertion #897439:
fof(ax3_3522,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoniclightcomconstablenotespdf1thessalonianspdf)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #240320:
fof(ax3_3523,axiom,(
    genls(c_centerofgeographicalregion,c_geographicalregion) )).

fof(ax3_3524,axiom,(
    ! [OBJ] :
      ( centerofgeographicalregion(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1209379:
fof(ax3_3525,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomhollywood1195patric1htm)),c_translation_27),c_basekb) )).

% Cyc Assertion #2182174:
fof(ax3_3526,axiom,(
    genlmt(c_tptp_member2810_mt,c_basekb) )).

% Cyc Assertion #829542:
fof(ax3_3527,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_11),c_basekb) )).

% Cyc Assertion #1182588:
fof(ax3_3528,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreachouttrustorgarticlesrelatedsubjectslegalismhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2249957:
fof(ax3_3529,axiom,
    ( mtvisible(c_tptp_member1514_mt)
   => tptpcol_16_121202(c_tptptptpcol_16_121202) )).

% Cyc Assertion #2181702:
fof(ax3_3530,axiom,(
    genlmt(c_tptp_member2692_mt,c_basekb) )).

% Cyc Assertion #528906:
fof(ax3_3531,axiom,(
    genls(c_threateningtodokilling_biologicalsubeventsasphyxiation,c_individual) )).

fof(ax3_3532,axiom,(
    ! [OBJ] :
      ( threateningtodokilling_biologicalsubeventsasphyxiation(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1479482:
fof(ax3_3533,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbarrsenglishclasscomcathedralhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182694:
fof(ax3_3534,axiom,(
    genlmt(c_tptp_member2940_mt,c_basekb) )).

% Cyc Assertion #2174284:
fof(ax3_3535,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member837_mt) )).

% Cyc Assertion #184800:
fof(ax3_3536,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_mine_excavationfacility))
     => individual(OBJ) ) )).

fof(ax3_3537,axiom,(
    genls(f_groupfn(c_mine_excavationfacility),c_individual) )).

fof(ax3_3538,axiom,(
    ! [OBJ] :
      ( groupfnmine_excavationfacility(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #818201:
fof(ax3_3539,axiom,(
    genls(c_declarativecontext,c_microtheory) )).

fof(ax3_3540,axiom,(
    ! [OBJ] :
      ( declarativecontext(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #1484000:
fof(ax3_3541,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetairlinecompanyairport_physical(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1087915:
fof(ax3_3542,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviepoopshootcomnewsaug027html)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1165218:
fof(ax3_3543,axiom,(
    genls(c_gourmetgiftbasket,c_artifact) )).

fof(ax3_3544,axiom,(
    ! [OBJ] :
      ( gourmetgiftbasket(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1403202:
fof(ax3_3545,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrtcolcomoaklandbrockhtml)),c_translation_3),c_basekb) )).

% Cyc Assertion #281930:
fof(ax3_3546,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwatlantanettourtravelseedocivilwar2aspx)),c_translation_31),c_basekb) )).

% Cyc Assertion #1297409:
fof(ax3_3547,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_unkown,c_actiononobject,s_340acd91_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_3548,axiom,(
    genls(f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_unkown,c_actiononobject,s_340acd91_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_3549,axiom,(
    ! [OBJ] :
      ( unsatisfactoryattempttofnpropersubcollectionnamedfn_ternaryunkownactiononobject340acd91_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1283688:
fof(ax3_3550,axiom,(
    individual(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordgarlandoffset0)),c_translation_27)) )).

% Cyc Assertion #1162022:
fof(ax3_3551,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetcollectionpredicate(OBJ)
     => mathematicalthing(OBJ) ) )).

% Cyc Assertion #2477449:
fof(ax3_3552,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x8_y22) )).

% Cyc Assertion #1659995:
fof(ax3_3553,axiom,(
    genls(c_ballisticmissile_minuteman3mark12a,c_individual) )).

fof(ax3_3554,axiom,(
    ! [OBJ] :
      ( ballisticmissile_minuteman3mark12a(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #471436:
fof(ax3_3555,axiom,(
    genls(c_symbolicobject,c_artifact) )).

fof(ax3_3556,axiom,(
    ! [OBJ] :
      ( symbolicobject(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1421097:
fof(ax3_3557,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwitvsorgoutsidelookinginfilmhtml)),c_translation_22),c_basekb) )).

% Cyc Assertion #1259922:
fof(ax3_3558,axiom,(
    genlmt(c_temporarylexicalassertions_paulsmt,c_basekb) )).

% Cyc Assertion #239259:
fof(ax3_3559,axiom,(
    genls(c_securitypractice_informationassurance,c_individual) )).

fof(ax3_3560,axiom,(
    ! [OBJ] :
      ( securitypractice_informationassurance(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1117831:
fof(ax3_3561,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwuk_roadsorgukarchivelocalauthorityboundarieshtml)),c_translation_31),c_basekb) )).

% Cyc Assertion #994359:
fof(ax3_3562,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwebazillionscomdvds_sling20bladehtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #2176286:
fof(ax3_3563,axiom,(
    genlmt(c_tptp_member1338_mt,c_basekb) )).

% Cyc Assertion #1559587:
fof(ax3_3564,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhcnorgservletshcnarticlearticle_id265)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #402278:
fof(ax3_3565,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_30),c_basekb) )).

% Cyc Assertion #1713361:
fof(ax3_3566,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_aksaray_provinceturkey) )).

% Cyc Assertion #818345:
fof(ax3_3567,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcanflixcomproductdetailaspxitem12245searchqcast3dbilly2bbob2bthornton)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176796:
fof(ax3_3568,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member1465_mt) )).

% Cyc Assertion #647580:
fof(ax3_3569,axiom,(
    genls(c_alchemytestorganization,c_individual) )).

fof(ax3_3570,axiom,(
    ! [OBJ] :
      ( alchemytestorganization(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2183278:
fof(ax3_3571,axiom,(
    genlmt(c_tptp_member3086_mt,c_basekb) )).

% Cyc Assertion #1591972:
fof(ax3_3572,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),f_glassboxallotmentfn(s_5a92e6bd_f727_4f58_93bc_7073c663adbe),c_nooescape_theprogram),c_nooescapearchitecturemt) )).

% Cyc Assertion #179253:
fof(ax3_3573,axiom,(
    genls(c_textualinferencelexiconspecification,c_individual) )).

fof(ax3_3574,axiom,(
    ! [OBJ] :
      ( textualinferencelexiconspecification(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1728809:
fof(ax3_3575,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoutherncteduorganizationshcr2002nonfictioncooperhtm)),c_translation_30),c_basekb) )).

% Cyc Assertion #1038733:
fof(ax3_3576,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_chemicalsubstancefn(c_cl2molecule))
     => partiallytangible(OBJ) ) )).

fof(ax3_3577,axiom,(
    genls(f_chemicalsubstancefn(c_cl2molecule),c_partiallytangible) )).

fof(ax3_3578,axiom,(
    ! [OBJ] :
      ( chemicalsubstancefncl2molecule(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1525226:
fof(ax3_3579,axiom,(
    genlmt(c_pq28mt,c_testvocabularymt) )).

% Cyc Assertion #1551852:
fof(ax3_3580,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_thing,c_rumorabout,c_thing))
     => thing(OBJ) ) )).

fof(ax3_3581,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_thing,c_rumorabout,c_thing),c_thing) )).

fof(ax3_3582,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnthingrumoraboutthing(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #342059:
fof(ax3_3583,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid106channel2)),c_translation_33),c_basekb) )).

% Cyc Assertion #1493018:
fof(ax3_3584,axiom,(
    genlmt(c_projectmanagementformulatemplatesmt,c_basekb) )).

% Cyc Assertion #2364165:
fof(ax3_3585,axiom,(
    ! [INS] :
      ( ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
        & adamite(INS) )
     => tptpofobject(INS,f_tptpquantityfn_17(n_957)) ) )).

fof(ax3_3586,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => relationallinstance(c_tptpofobject,c_adamite,f_tptpquantityfn_17(n_957)) )).

% Cyc Assertion #1493866:
fof(ax3_3587,axiom,
    ( mtvisible(c_cycnounlearnermt)
   => genls(c_helm_1,c_location_underspecified) )).

fof(ax3_3588,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_cycnounlearnermt)
        & helm_1(OBJ) )
     => location_underspecified(OBJ) ) )).

% Cyc Assertion #1199457:
fof(ax3_3589,axiom,(
    genlmt(c_miptdatabase19681997_temporarymt,c_basekb) )).

% Cyc Assertion #393258:
fof(ax3_3590,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_sodiumpicrate,c_partiallytangible) )).

fof(ax3_3591,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & sodiumpicrate(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #364880:
fof(ax3_3592,axiom,(
    genls(c_attemptingkilling_biologicalsubeventsshootingaprojectileweapon,c_individual) )).

fof(ax3_3593,axiom,(
    ! [OBJ] :
      ( attemptingkilling_biologicalsubeventsshootingaprojectileweapon(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1405963:
fof(ax3_3594,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordtrueliesoffset0)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1051486:
fof(ax3_3595,axiom,(
    genls(c_ruggedterrain,c_geographicalregion) )).

fof(ax3_3596,axiom,(
    ! [OBJ] :
      ( ruggedterrain(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1474578:
fof(ax3_3597,axiom,(
    genlmt(c_stimsoncentermt,c_basekb) )).

% Cyc Assertion #1408889:
fof(ax3_3598,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhouseofpoebigtownfilmpostersorgid22htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1276632:
fof(ax3_3599,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwatlantanettourtravelseedocivilwar2aspx)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1558359:
fof(ax3_3600,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_20),c_machinelearningspindleheadmt) )).

% Cyc Assertion #288026:
fof(ax3_3601,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_event_ks),c_basekb) )).

% Cyc Assertion #1201879:
fof(ax3_3602,axiom,
    ( mtvisible(c_ldscexperimentaltermsmt)
   => genls(c_sodiumdiuranate,c_inanimateobject) )).

fof(ax3_3603,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_ldscexperimentaltermsmt)
        & sodiumdiuranate(OBJ) )
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #631407:
fof(ax3_3604,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => unitofmoneytypebygeopoliticalentity(f_unitofmoneyofgeopoliticalentityfn(c_laos)) )).

% Cyc Assertion #952915:
fof(ax3_3605,axiom,(
    genls(c_sidam25quadrupleaamobilesystem,c_individual) )).

fof(ax3_3606,axiom,(
    ! [OBJ] :
      ( sidam25quadrupleaamobilesystem(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #598072:
fof(ax3_3607,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_29),c_basekb) )).

% Cyc Assertion #1385747:
fof(ax3_3608,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthebusinesstravelreportcompagessouthamericacitiescolombiabogotageneralinformationhtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #651603:
fof(ax3_3609,axiom,(
    physicalorderingpredicate(c_hangsfrom) )).

% Cyc Assertion #713528:
fof(ax3_3610,axiom,(
    genlmt(c_modernwesternmedicinemt,c_basekb) )).

% Cyc Assertion #221591:
fof(ax3_3611,axiom,(
    genlmt(f_contextofpcwfn(c_fbireporttojudgegaleanoonamiabombing),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1477685:
fof(ax3_3612,axiom,(
    genls(c_actiontype_genericsocial,c_collection) )).

fof(ax3_3613,axiom,(
    ! [OBJ] :
      ( actiontype_genericsocial(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #789820:
fof(ax3_3614,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwabcnetaunewenglandmornings)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #900927:
fof(ax3_3615,axiom,(
    genls(c_banshee,c_individual) )).

fof(ax3_3616,axiom,(
    ! [OBJ] :
      ( banshee(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #264229:
fof(ax3_3617,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_report_ks),c_basekb) )).

% Cyc Assertion #1028400:
fof(ax3_3618,axiom,(
    genlmt(c_southernhemispheremt,c_basekb) )).

% Cyc Assertion #694380:
fof(ax3_3619,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwheritagepreservationorghhicase276html)),c_translation_32),c_basekb) )).

% Cyc Assertion #1409041:
fof(ax3_3620,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_techspecsacalltodutycomneworleanshtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #2178182:
fof(ax3_3621,axiom,(
    genlmt(c_tptp_member1812_mt,c_basekb) )).

% Cyc Assertion #629084:
fof(ax3_3622,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthecitizencomqnode2339)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2463146:
fof(ax3_3623,axiom,(
    genlmt(c_tptpgeo_member3_mt,c_tptpgeo_spindleheadmt) )).

% Cyc Assertion #1022376:
fof(ax3_3624,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_voanewscomspecialenglisharchivea_2002_02_22_3_1cfm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #683795:
fof(ax3_3625,axiom,(
    genlmt(c_devilsbrewbriefingsmt,c_hpkbvocabmt) )).

% Cyc Assertion #339889:
fof(ax3_3626,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordvidoroffset0)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1622689:
fof(ax3_3627,axiom,(
    individual(c_nightcourt_thetvshow) )).

% Cyc Assertion #2183542:
fof(ax3_3628,axiom,(
    genlmt(c_tptp_member3152_mt,c_basekb) )).

% Cyc Assertion #674810:
fof(ax3_3629,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_medeasmedialistsblueblogchcinema)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #368508:
fof(ax3_3630,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkentuckycommldheraldleadersports6546184htm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #513258:
fof(ax3_3631,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcommongroundcommonsenseorgforumsindexphpshowtopic10194viewgetlastpost)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1365123:
fof(ax3_3632,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionbyregionfn(c_thenchead,f_somefn(c_thencmodifier)))
     => individual(OBJ) ) )).

fof(ax3_3633,axiom,(
    genls(f_subcollectionbyregionfn(c_thenchead,f_somefn(c_thencmodifier)),c_individual) )).

fof(ax3_3634,axiom,(
    ! [OBJ] :
      ( subcollectionbyregionfnthencheadsomefnthencmodifier(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2477911:
fof(ax3_3635,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x25_y25) )).

% Cyc Assertion #1478071:
fof(ax3_3636,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetchemicallybasicsubstancechlorine(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #902798:
fof(ax3_3637,axiom,(
    genlmt(f_contentmtfn(c_fg1_name_id_nga_xref_ks),c_basekb) )).

% Cyc Assertion #1149067:
fof(ax3_3638,axiom,(
    genlmt(c_pointbasedgeometryvocabularymt,c_basekb) )).

% Cyc Assertion #663495:
fof(ax3_3639,axiom,(
    genls(c_attemptedkillingbyasphyxiation,c_individual) )).

fof(ax3_3640,axiom,(
    ! [OBJ] :
      ( attemptedkillingbyasphyxiation(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #165051:
fof(ax3_3641,axiom,(
    genlmt(c_skillleveltestingmt,c_cyclistsmt) )).

% Cyc Assertion #751584:
fof(ax3_3642,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_filmguardiancoukfeature_storyobserver041202538500html)),c_translation_0),c_basekb) )).

% Cyc Assertion #1221529:
fof(ax3_3643,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_19),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176826:
fof(ax3_3644,axiom,(
    genlmt(c_tptp_member1473_mt,c_basekb) )).

% Cyc Assertion #2181058:
fof(ax3_3645,axiom,(
    genlmt(c_tptp_member2531_mt,c_basekb) )).

% Cyc Assertion #686970:
fof(ax3_3646,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_book_axis_of_evil_iran_hizballah_and_the_palestinian_terror_the),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #981321:
fof(ax3_3647,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_14),c_basekb) )).

% Cyc Assertion #913822:
fof(ax3_3648,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpenpushercomclientssamplesatlantahtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173082:
fof(ax3_3649,axiom,(
    genlmt(c_tptp_member537_mt,c_basekb) )).

% Cyc Assertion #2179170:
fof(ax3_3650,axiom,(
    genlmt(c_tptp_member2059_mt,c_basekb) )).

% Cyc Assertion #1604009:
fof(ax3_3651,axiom,(
    genlmt(c_mayasourcemt,c_basekb) )).

% Cyc Assertion #1282566:
fof(ax3_3652,axiom,(
    genlmt(c_pathsystemsvocabularymt,c_basekb) )).

% Cyc Assertion #813756:
fof(ax3_3653,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_20),c_machinelearningspindleheadmt) )).

% Cyc Assertion #301351:
fof(ax3_3654,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreadiocomarchives030205bbroadway5html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #682266:
fof(ax3_3655,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forummuppetcentralcomprintthreadphpt17282page3pp15)),c_translation_33),c_basekb) )).

% Cyc Assertion #1386100:
fof(ax3_3656,axiom,(
    genls(c_webgatheredgafmicrotheory,c_microtheory) )).

fof(ax3_3657,axiom,(
    ! [OBJ] :
      ( webgatheredgafmicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #934349:
fof(ax3_3658,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdannygoldbergcomabouthtml)),c_translation_31),c_basekb) )).

% Cyc Assertion #639606:
fof(ax3_3659,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplecftppypeoplecchristiedougcanadaright)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #748334:
fof(ax3_3660,axiom,(
    genlmt(c_transportationplanningmt,c_basekb) )).

% Cyc Assertion #2179870:
fof(ax3_3661,axiom,(
    genlmt(c_tptp_member2234_mt,c_basekb) )).

% Cyc Assertion #599590:
fof(ax3_3662,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_legendstypepadcomliving_with_legends_the_h200507cult_fictionhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #1527570:
fof(ax3_3663,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbraintrustdvcomessaysdigital_ragehtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #1138717:
fof(ax3_3664,axiom,(
    genls(c_cycinternaltask_researchcyc_project_the_72,c_individual) )).

fof(ax3_3665,axiom,(
    ! [OBJ] :
      ( cycinternaltask_researchcyc_project_the_72(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2482647:
fof(ax3_3666,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x58_y9) )).

% Cyc Assertion #170089:
fof(ax3_3667,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #243236:
fof(ax3_3668,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcresourceiorgbiblestudybb1cor2html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1726891:
fof(ax3_3669,axiom,(
    genls(c_contraband,c_partiallytangible) )).

fof(ax3_3670,axiom,(
    ! [OBJ] :
      ( contraband(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1660894:
fof(ax3_3671,axiom,(
    genlmt(c_temporarylexicalassertions_tomwmt,c_basekb) )).

% Cyc Assertion #1488600:
fof(ax3_3672,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_refugee))
     => partiallytangible(OBJ) ) )).

fof(ax3_3673,axiom,(
    genls(f_groupfn(c_refugee),c_partiallytangible) )).

fof(ax3_3674,axiom,(
    ! [OBJ] :
      ( groupfnrefugee(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #713148:
fof(ax3_3675,axiom,(
    genls(c_textualinferenceprobleminvolvingsenseextension,c_individual) )).

fof(ax3_3676,axiom,(
    ! [OBJ] :
      ( textualinferenceprobleminvolvingsenseextension(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #634422:
fof(ax3_3677,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwswordandsorceryorgwormouroborosasp)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2322964:
fof(ax3_3678,axiom,(
    genlmt(c_tptpmissionspecificationmicrotheory,c_basekb) )).

% Cyc Assertion #1648888:
fof(ax3_3679,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcwrueduartscienglmarlinghardboiledothermediahtm)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2484464:
fof(ax3_3680,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x80_y44) )).

% Cyc Assertion #2207183:
fof(ax3_3681,axiom,(
    genlmt(c_theprototypicalcycbehaviorengineactionhistory,c_basekb) )).

% Cyc Assertion #2227784:
fof(ax3_3682,axiom,
    ( mtvisible(c_tptp_member1925_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_20) )).

% Cyc Assertion #2171798:
fof(ax3_3683,axiom,(
    genlmt(c_tptp_member216_mt,c_basekb) )).

% Cyc Assertion #2171638:
fof(ax3_3684,axiom,(
    genlmt(c_tptp_member176_mt,c_basekb) )).

% Cyc Assertion #2177762:
fof(ax3_3685,axiom,(
    genlmt(c_tptp_member1707_mt,c_basekb) )).

% Cyc Assertion #872535:
fof(ax3_3686,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomhowardhawks)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185186:
fof(ax3_3687,axiom,(
    genlmt(c_tptp_member3563_mt,c_basekb) )).

% Cyc Assertion #594795:
fof(ax3_3688,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_listsibiblioorgpipermailcorpus_paul20020509003396html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1620899:
fof(ax3_3689,axiom,(
    genlmt(c_reasoningaboutdiscourseprecedencemt,c_basekb) )).

% Cyc Assertion #1356979:
fof(ax3_3690,axiom,(
    genlmt(c_ofacinterestingnessrulesmt,c_basekb) )).

% Cyc Assertion #192069:
fof(ax3_3691,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetsurfaceregion_infiniteconicalsurface_withoutbase(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #531488:
fof(ax3_3692,axiom,(
    firstordercollection(c_scoringstrategy) )).

% Cyc Assertion #1106740:
fof(ax3_3693,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstone_campbelljournalcomcurrentbookreviewsbreviewshtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #249193:
fof(ax3_3694,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_collectionintersection2fn(c_thenchead,f_groupfn(c_thencmodifier)))
     => individual(OBJ) ) )).

fof(ax3_3695,axiom,(
    genls(f_collectionintersection2fn(c_thenchead,f_groupfn(c_thencmodifier)),c_individual) )).

fof(ax3_3696,axiom,(
    ! [OBJ] :
      ( collectionintersection2fnthencheadgroupfnthencmodifier(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1542752:
fof(ax3_3697,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom200507our_fordhtml)),c_translation_6),c_basekb) )).

% Cyc Assertion #1307216:
fof(ax3_3698,axiom,(
    genlmt(c_y1phase1_stage4mt,c_basekb) )).

% Cyc Assertion #1397825:
fof(ax3_3699,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #491167:
fof(ax3_3700,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomresearchtrianglelab4191millermillershtml)),c_translation_29),c_basekb) )).

% Cyc Assertion #705753:
fof(ax3_3701,axiom,(
    genlmt(f_usermodelmtfn(c_eii_user2),c_basekb) )).

% Cyc Assertion #892943:
fof(ax3_3702,axiom,(
    genls(c_winechiller,c_individual) )).

fof(ax3_3703,axiom,(
    ! [OBJ] :
      ( winechiller(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #430503:
fof(ax3_3704,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgnutellacomnews14796)),c_translation_33),c_basekb) )).

% Cyc Assertion #1175701:
fof(ax3_3705,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommshtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #952701:
fof(ax3_3706,axiom,(
    genlmt(c_machinelearningspindleheadmt,c_saicbioterrorismeventsdatamt) )).

% Cyc Assertion #2172378:
fof(ax3_3707,axiom,(
    genlmt(c_tptp_member361_mt,c_basekb) )).

% Cyc Assertion #586506:
fof(ax3_3708,axiom,(
    genlmt(c_uia_worldleaders_demoenvironmentmt,c_basekb) )).

% Cyc Assertion #1589675:
fof(ax3_3709,axiom,(
    genls(c_indexedinformationsource,c_aspatialinformationstore) )).

fof(ax3_3710,axiom,(
    ! [OBJ] :
      ( indexedinformationsource(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1027391:
fof(ax3_3711,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetcbltaskmethodcblsensationmethodcblmessagemethod(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #614305:
fof(ax3_3712,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhighbeamcomrefdoc0aspdocid1e1_indianap)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #751456:
fof(ax3_3713,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_syrias_intelligence_services_origins_and_development),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #1204641:
fof(ax3_3714,axiom,(
    individual(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_themoviefanaticblogspotcom200511rear_window_1954html)),c_translation_31)) )).

% Cyc Assertion #553899:
fof(ax3_3715,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_murderanationalconferenceleader,c_actiononobject,s_3401a5d3_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_3716,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_murderanationalconferenceleader,c_actiononobject,s_3401a5d3_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_3717,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarymurderanationalconferenceleaderactiononobject3401a5d3_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #925554:
fof(ax3_3718,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmqmorgenglish_newsnov_2004news041106htm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #805903:
fof(ax3_3719,axiom,(
    genlmt(c_chemicalweaponsdestructioninrussiamt,c_basekb) )).

% Cyc Assertion #852455:
fof(ax3_3720,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_12),c_basekb) )).

% Cyc Assertion #323087:
fof(ax3_3721,axiom,(
    arg2isa(c_exceptionforsemtranstemplate,c_collection) )).

fof(ax3_3722,axiom,(
    ! [ARG1,ARG2] :
      ( exceptionforsemtranstemplate(ARG1,ARG2)
     => collection(ARG2) ) )).

% Cyc Assertion #1524467:
fof(ax3_3723,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1281628:
fof(ax3_3724,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_9),c_basekb) )).

% Cyc Assertion #1518771:
fof(ax3_3725,axiom,(
    individual(f_computervulnerabilityreportfn(c_bugtraqfaultdatabase,s_825)) )).

% Cyc Assertion #2348914:
fof(ax3_3726,axiom,
    ( mtvisible(c_tptp_member1014_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_22) )).

% Cyc Assertion #1332686:
fof(ax3_3727,axiom,(
    genlmt(c_biologicalwarfaredemoenvironmentmt,c_basekb) )).

% Cyc Assertion #2429278:
fof(ax3_3728,axiom,
    ( mtvisible(c_cyclistsmt)
   => missilelauncher_indirect(c_tptpmissilelauncher_indirect_4) )).

% Cyc Assertion #2184282:
fof(ax3_3729,axiom,(
    genlmt(c_tptp_member3337_mt,c_basekb) )).

% Cyc Assertion #1003554:
fof(ax3_3730,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiplacesftppyplacescanadacanadaright)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #580681:
fof(ax3_3731,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_link_ks),c_basekb) )).

% Cyc Assertion #1615692:
fof(ax3_3732,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archivestcmiebreakingnews20030903story112045asp)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #791597:
fof(ax3_3733,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsimonsayscomtitles0684810948authorhtml)),c_translation_7),c_basekb) )).

% Cyc Assertion #555872:
fof(ax3_3734,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetfemalehumanactor(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #467477:
fof(ax3_3735,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcscholarcomobs52bl000033htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #694670:
fof(ax3_3736,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwntrminorgcatholic_but_not_roman_catholic_01htm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1768024:
fof(ax3_3737,axiom,(
    genlmt(c_pq7mt,c_basekb) )).

% Cyc Assertion #863616:
fof(ax3_3738,axiom,(
    genls(c_collectiontype,c_collection) )).

fof(ax3_3739,axiom,(
    ! [OBJ] :
      ( collectiontype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1447020:
fof(ax3_3740,axiom,(
    genlmt(c_htmlrepresentationmt,c_basekb) )).

% Cyc Assertion #935007:
fof(ax3_3741,axiom,(
    genls(c_city_pla001_1,c_individual) )).

fof(ax3_3742,axiom,(
    ! [OBJ] :
      ( city_pla001_1(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1027942:
fof(ax3_3743,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordhitsoffset0)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #344461:
fof(ax3_3744,axiom,(
    genlmt(c_myseanonuserlexicalmt2016056851_3,c_basekb) )).

% Cyc Assertion #561358:
fof(ax3_3745,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_collegehmcocomhistoryreaderscompgahffhtmlff_103400_jonesjameseahtm)),c_translation_14),c_basekb) )).

% Cyc Assertion #806758:
fof(ax3_3746,axiom,(
    genlmt(f_contentmtfn(c_fg1_subsid2_ks),c_basekb) )).

% Cyc Assertion #1494491:
fof(ax3_3747,axiom,(
    reflexivebinarypredicate(c_inregion) )).

% Cyc Assertion #531766:
fof(ax3_3748,axiom,(
    genlmt(c_organizationdatamt,c_nonusprofessionalsportsmt) )).

% Cyc Assertion #1028354:
fof(ax3_3749,axiom,(
    genls(c_information_content,c_aspatialinformationstore) )).

fof(ax3_3750,axiom,(
    ! [OBJ] :
      ( information_content(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #144119:
fof(ax3_3751,axiom,(
    genls(c_attemptingkilling_biologicalsubeventspoisoningviasubstanceradioactivestuff,c_individual) )).

fof(ax3_3752,axiom,(
    ! [OBJ] :
      ( attemptingkilling_biologicalsubeventspoisoningviasubstanceradioactivestuff(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #436448:
fof(ax3_3753,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamctvcompersondetailcid8142_1_pst)),c_translation_32),c_basekb) )).

% Cyc Assertion #676271:
fof(ax3_3754,axiom,(
    genlmt(c_cycorpproductsmt,c_pcwdatamt) )).

% Cyc Assertion #664721:
fof(ax3_3755,axiom,(
    genlmt(c_scottishenglishmt,c_basekb) )).

% Cyc Assertion #977621:
fof(ax3_3756,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_netessaysnetviewpaper8968html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1705572:
fof(ax3_3757,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_smallarm_weapon))
     => partiallytangible(OBJ) ) )).

fof(ax3_3758,axiom,(
    genls(f_groupfn(c_smallarm_weapon),c_partiallytangible) )).

fof(ax3_3759,axiom,(
    ! [OBJ] :
      ( groupfnsmallarm_weapon(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #537730:
fof(ax3_3760,axiom,(
    genls(c_state_geopolitical,c_firstorderadministrativedivision) )).

fof(ax3_3761,axiom,(
    ! [OBJ] :
      ( state_geopolitical(OBJ)
     => firstorderadministrativedivision(OBJ) ) )).

% Cyc Assertion #2173430:
fof(ax3_3762,axiom,(
    genlmt(c_tptp_member624_mt,c_basekb) )).

% Cyc Assertion #855699:
fof(ax3_3763,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_20915764200bulldogsin_forum)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #835563:
fof(ax3_3764,axiom,(
    genls(c_straight,c_partiallytangible) )).

fof(ax3_3765,axiom,(
    ! [OBJ] :
      ( straight(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2275738:
fof(ax3_3766,axiom,(
    executionbyfiringsquad(c_tptpexecutionbyfiringsquad_52) )).

% Cyc Assertion #788591:
fof(ax3_3767,axiom,(
    genls(c_mob,c_partiallytangible) )).

fof(ax3_3768,axiom,(
    ! [OBJ] :
      ( mob(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1027333:
fof(ax3_3769,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_17),c_basekb) )).

% Cyc Assertion #2477374:
fof(ax3_3770,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x6_y1) )).

% Cyc Assertion #1736972:
fof(ax3_3771,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1490525:
fof(ax3_3772,axiom,(
    genls(c_scripttypebystructuralorderfeature,c_collection) )).

fof(ax3_3773,axiom,(
    ! [OBJ] :
      ( scripttypebystructuralorderfeature(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #2178410:
fof(ax3_3774,axiom,(
    genlmt(c_tptp_member1869_mt,c_basekb) )).

% Cyc Assertion #2189991:
fof(ax3_3775,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => tptptypes_9_693(f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma),c_tptpcol_15_27122) )).

% Cyc Assertion #2172206:
fof(ax3_3776,axiom,(
    genlmt(c_tptp_member318_mt,c_basekb) )).

% Cyc Assertion #1047727:
fof(ax3_3777,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_realtimemt) )).

% Cyc Assertion #2178222:
fof(ax3_3778,axiom,(
    genlmt(c_tptp_member1822_mt,c_basekb) )).

% Cyc Assertion #712317:
fof(ax3_3779,axiom,
    ( mtvisible(c_literarypeopledatamt)
   => malehuman(c_rudywiebe) )).

% Cyc Assertion #1516995:
fof(ax3_3780,axiom,(
    genls(c_tacticalterraintype,c_collection) )).

fof(ax3_3781,axiom,(
    ! [OBJ] :
      ( tacticalterraintype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1524560:
fof(ax3_3782,axiom,(
    genlmt(c_americanprofessionalsportsmt,c_basekb) )).

% Cyc Assertion #202121:
fof(ax3_3783,axiom,(
    genlmt(c_readingtextvisualizationquerymt,c_testvocabularymt) )).

% Cyc Assertion #1768221:
fof(ax3_3784,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetclericnunmonk(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2482765:
fof(ax3_3785,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x59_y46) )).

% Cyc Assertion #2180806:
fof(ax3_3786,axiom,(
    genlmt(c_tptp_member2468_mt,c_basekb) )).

% Cyc Assertion #1632500:
fof(ax3_3787,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_22),c_basekb) )).

% Cyc Assertion #1536910:
fof(ax3_3788,axiom,(
    genlmt(c_temporarylexicalassertions_kimlmt,c_basekb) )).

% Cyc Assertion #2118071:
fof(ax3_3789,axiom,(
    genls(c_tptpcol_13_118132,c_tptpcol_12_118116) )).

fof(ax3_3790,axiom,(
    ! [OBJ] :
      ( tptpcol_13_118132(OBJ)
     => tptpcol_12_118116(OBJ) ) )).

% Cyc Assertion #1728476:
fof(ax3_3791,axiom,(
    genlmt(c_pq68mt,c_basekb) )).

% Cyc Assertion #1206594:
fof(ax3_3792,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_mihtm)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1800587:
fof(ax3_3793,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwshowbizirelandcomnewsjuly0401_neiljordan03shtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176942:
fof(ax3_3794,axiom,(
    genlmt(c_tptp_member1502_mt,c_basekb) )).

% Cyc Assertion #325551:
fof(ax3_3795,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreadiocomarchives030205bbroadway5html)),c_translation_32),c_basekb) )).

% Cyc Assertion #1662680:
fof(ax3_3796,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom200507our_fordhtml)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1491535:
fof(ax3_3797,axiom,(
    genls(c_layer,c_partiallytangible) )).

fof(ax3_3798,axiom,(
    ! [OBJ] :
      ( layer(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1021129:
fof(ax3_3799,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentshowbiz1475583stm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2180254:
fof(ax3_3800,axiom,(
    genlmt(c_tptp_member2330_mt,c_basekb) )).

% Cyc Assertion #802556:
fof(ax3_3801,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecoukforumtmaspm62284mpage2key)),c_translation_2),c_basekb) )).

% Cyc Assertion #814451:
fof(ax3_3802,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtranscriptsnettranscriptsfilmweekfilmweekdocumentsfw20040702doc)),c_translation_33),c_basekb) )).

% Cyc Assertion #1659556:
fof(ax3_3803,axiom,
    ( mtvisible(c_englishmt)
   => prettystring(f_subcollectionofwithrelationtotypefn(c_selectingsomething,c_chosenitem,c_creditcard),s_willchooseacreditcard) )).

% Cyc Assertion #1800582:
fof(ax3_3804,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoutherncteduorganizationshcr2002nonfictioncooperhtm)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172650:
fof(ax3_3805,axiom,(
    genlmt(c_tptp_member429_mt,c_basekb) )).

% Cyc Assertion #1693796:
fof(ax3_3806,axiom,(
    genlmt(c_sksicontentcollectormt,c_basekb) )).

% Cyc Assertion #2290994:
fof(ax3_3807,axiom,
    ( mtvisible(c_tptp_member495_mt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_27) )).

% Cyc Assertion #578575:
fof(ax3_3808,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecomforumtmaspm62284mpage5)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1492441:
fof(ax3_3809,axiom,
    ( mtvisible(c_unitedstatesgeographymt)
   => city(c_cityofcolumbiacalifornia) )).

% Cyc Assertion #2171694:
fof(ax3_3810,axiom,(
    genlmt(c_tptp_member190_mt,c_basekb) )).

% Cyc Assertion #1441542:
fof(ax3_3811,axiom,(
    genlmt(c_saffronandkbinterestingnessrulesmt,c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #2185166:
fof(ax3_3812,axiom,(
    genlmt(c_tptp_member3558_mt,c_basekb) )).

% Cyc Assertion #748538:
fof(ax3_3813,axiom,(
    genlmt(c_pq211mt,c_basekb) )).

% Cyc Assertion #1041634:
fof(ax3_3814,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrhdservicescomrhd20serviceshtm)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #899860:
fof(ax3_3815,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfree_researchpaperscomdbsa3bqg32shtml)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1118542:
fof(ax3_3816,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikimeasles)),c_translation_33),c_basekb) )).

% Cyc Assertion #1713592:
fof(ax3_3817,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpvponlinecomnewsproarchivesarc7_2003html)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1873958:
fof(ax3_3818,axiom,(
    genls(c_tptpcol_6_20484,c_tptpcol_5_20483) )).

fof(ax3_3819,axiom,(
    ! [OBJ] :
      ( tptpcol_6_20484(OBJ)
     => tptpcol_5_20483(OBJ) ) )).

% Cyc Assertion #1413363:
fof(ax3_3820,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_15),c_machinelearningspindleheadmt) )).

% Cyc Assertion #733100:
fof(ax3_3821,axiom,(
    genlmt(c_needsoelexicalmt,c_basekb) )).

% Cyc Assertion #701569:
fof(ax3_3822,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_grocerymarketcategory))
     => partiallytangible(OBJ) ) )).

fof(ax3_3823,axiom,(
    genls(f_groupfn(c_grocerymarketcategory),c_partiallytangible) )).

fof(ax3_3824,axiom,(
    ! [OBJ] :
      ( groupfngrocerymarketcategory(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2185634:
fof(ax3_3825,axiom,(
    genlmt(c_tptp_member3675_mt,c_basekb) )).

% Cyc Assertion #630694:
fof(ax3_3826,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_listsibiblioorgpipermailcorpus_paul20020509003396html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #331381:
fof(ax3_3827,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmacupdatecomreviewsphpid18527pid123057)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1669725:
fof(ax3_3828,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgodrulesnetlibraryrobertrobertact28htm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1355360:
fof(ax3_3829,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertoffset0)),c_translation_33),c_basekb) )).

% Cyc Assertion #571691:
fof(ax3_3830,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtnttvtitleoid324281_1151)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1299743:
fof(ax3_3831,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgradewinnercomparticlesmi_m1285is_7_33ai_105735842)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1380677:
fof(ax3_3832,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomhollywood1195patric1htm)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #944721:
fof(ax3_3833,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrediffcomnews2003oct02spechtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #245260:
fof(ax3_3834,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_attemptedassassinationofchechenadministratormuftiakhmedkadyrov,c_actiononobject,s_34141c62_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_3835,axiom,(
    genls(f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_attemptedassassinationofchechenadministratormuftiakhmedkadyrov,c_actiononobject,s_34141c62_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_3836,axiom,(
    ! [OBJ] :
      ( unsatisfactoryattempttofnpropersubcollectionnamedfn_ternaryattemptedassassinationofchechenadministratormuftiakhmedkadyrovactiononobject34141c62_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #315131:
fof(ax3_3837,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwunomahaedujrfduvallpbhtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1358851:
fof(ax3_3838,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfaithfirstcomhtmlcatechistvideoliturgyasp)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #598566:
fof(ax3_3839,axiom,(
    arg2isa(c_most,c_setorcollection) )).

fof(ax3_3840,axiom,(
    ! [ARG1,ARG2] :
      ( most(ARG1,ARG2)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #244544:
fof(ax3_3841,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomjames_cutter001rmhtm)),c_translation_29),c_basekb) )).

% Cyc Assertion #641036:
fof(ax3_3842,axiom,(
    genlmt(c_corpuslexicalmt,c_basekb) )).

% Cyc Assertion #1451705:
fof(ax3_3843,axiom,(
    genlmt(c_analogicalreasoningmt,c_basekb) )).

% Cyc Assertion #2179302:
fof(ax3_3844,axiom,(
    genlmt(c_tptp_member2092_mt,c_basekb) )).

% Cyc Assertion #1559133:
fof(ax3_3845,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_two_detainees_of_damascus_spring_released_after_the_expiry_of_their_sentences),c_ldscgeneralcollectormt) )).

% Cyc Assertion #2106908:
fof(ax3_3846,axiom,(
    genls(c_tptpcol_7_113665,c_tptpcol_6_112641) )).

fof(ax3_3847,axiom,(
    ! [OBJ] :
      ( tptpcol_7_113665(OBJ)
     => tptpcol_6_112641(OBJ) ) )).

% Cyc Assertion #2183102:
fof(ax3_3848,axiom,(
    genlmt(c_tptp_member3042_mt,c_basekb) )).

% Cyc Assertion #234204:
fof(ax3_3849,axiom,(
    genls(c_pathartifactsystem,c_inanimateobject_nonnatural) )).

fof(ax3_3850,axiom,(
    ! [OBJ] :
      ( pathartifactsystem(OBJ)
     => inanimateobject_nonnatural(OBJ) ) )).

% Cyc Assertion #226516:
fof(ax3_3851,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwartstelegraphcoukcoreslideshowslideshowcontentframefragjhtmlxmlnews20040702brandobrandoslide2xml)),c_translation_33),c_basekb) )).

% Cyc Assertion #585749:
fof(ax3_3852,axiom,(
    genls(c_benzene,c_partiallytangible) )).

fof(ax3_3853,axiom,(
    ! [OBJ] :
      ( benzene(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #355765:
fof(ax3_3854,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richlabontenetexonewsxtra3strange_quarkshtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176042:
fof(ax3_3855,axiom,(
    genlmt(c_tptp_member1277_mt,c_basekb) )).

% Cyc Assertion #2217241:
fof(ax3_3856,axiom,
    ( mtvisible(c_cyclistsmt)
   => isa(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_678,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )).

fof(ax3_3857,axiom,
    ( mtvisible(c_cyclistsmt)
   => subcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_678) )).

% Cyc Assertion #1441121:
fof(ax3_3858,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstpuheduvol6772shobizshobiz_indexhtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #900456:
fof(ax3_3859,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_memberstripodcomindygalfordtriviahtm)),c_translation_31),c_basekb) )).

% Cyc Assertion #2265956:
fof(ax3_3860,axiom,(
    isa(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_229,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )).

fof(ax3_3861,axiom,(
    subcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_229) )).

% Cyc Assertion #2183094:
fof(ax3_3862,axiom,(
    genlmt(c_tptp_member3040_mt,c_basekb) )).

% Cyc Assertion #620953:
fof(ax3_3863,axiom,(
    genlmt(c_uia_coabackgroundscenarioauthoring_demoenvironmentmt,c_cycorpproductsmt) )).

% Cyc Assertion #2175946:
fof(ax3_3864,axiom,(
    genlmt(c_tptp_member1253_mt,c_basekb) )).

% Cyc Assertion #828363:
fof(ax3_3865,axiom,(
    genls(c_askingtheuserayesornoquestioninuia,c_individual) )).

fof(ax3_3866,axiom,(
    ! [OBJ] :
      ( askingtheuserayesornoquestioninuia(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1528979:
fof(ax3_3867,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcwrueduartscienglmarlinghardboiledothermediahtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #2176166:
fof(ax3_3868,axiom,(
    genlmt(c_tptp_member1308_mt,c_basekb) )).

% Cyc Assertion #1491583:
fof(ax3_3869,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_entitygroup_ks),c_basekb) )).

% Cyc Assertion #709061:
fof(ax3_3870,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwneedfreeessayscomviewpaper70802html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #932960:
fof(ax3_3871,axiom,(
    genlmt(c_querylibraryintegrateddatasourcesquerymt,c_basekb) )).

% Cyc Assertion #2173543:
fof(ax3_3872,axiom,(
    genlmt(c_tptp_member652_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #2182210:
fof(ax3_3873,axiom,(
    genlmt(c_tptp_member2819_mt,c_basekb) )).

% Cyc Assertion #270335:
fof(ax3_3874,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_producthalfebaycomthe_great_gatsby_w0qqprz11947qqtgzinfo)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182738:
fof(ax3_3875,axiom,(
    genlmt(c_tptp_member2951_mt,c_basekb) )).

% Cyc Assertion #652949:
fof(ax3_3876,axiom,(
    genlmt(c_simpleastronomymt,c_basekb) )).

% Cyc Assertion #189709:
fof(ax3_3877,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaquariusrecordsorgcatd10html)),c_translation_32),c_basekb) )).

% Cyc Assertion #1592642:
fof(ax3_3878,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_blogouter_courtcomegobrowsertim_allenhtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #500277:
fof(ax3_3879,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1787121:
fof(ax3_3880,axiom,(
    genls(c_hydropower,c_individual) )).

fof(ax3_3881,axiom,(
    ! [OBJ] :
      ( hydropower(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1478525:
fof(ax3_3882,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_peopleulethcapeteralwardcourseslanguagelang02pn_puzzleshtm)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1619352:
fof(ax3_3883,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbedandbreakfasts_ukcoukguide_belfasthtm)),c_translation_1),c_basekb) )).

% Cyc Assertion #660521:
fof(ax3_3884,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentfilm4009157stm)),c_translation_26),c_basekb) )).

% Cyc Assertion #1344832:
fof(ax3_3885,axiom,(
    genlmt(c_ldformulatemplatesmt,c_testvocabularymt) )).

% Cyc Assertion #2186850:
fof(ax3_3886,axiom,(
    genlmt(c_tptp_member3979_mt,c_basekb) )).

% Cyc Assertion #1595779:
fof(ax3_3887,axiom,(
    genls(c_unpleasanttaste,c_partiallytangible) )).

fof(ax3_3888,axiom,(
    ! [OBJ] :
      ( unpleasanttaste(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1481719:
fof(ax3_3889,axiom,(
    genls(c_administeringcivilians,c_individual) )).

fof(ax3_3890,axiom,(
    ! [OBJ] :
      ( administeringcivilians(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1711284:
fof(ax3_3891,axiom,(
    genls(c_railway_siding,c_partiallytangible) )).

fof(ax3_3892,axiom,(
    ! [OBJ] :
      ( railway_siding(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #397823:
fof(ax3_3893,axiom,(
    individual(f_urifn(s_http_englishpeoplecomcnenglish20010912eng20010912_79948html)) )).

% Cyc Assertion #278946:
fof(ax3_3894,axiom,(
    genlmt(c_ldscdemonstrationspindleheadmt,c_ldscexperimentaltermsmt) )).

% Cyc Assertion #1630400:
fof(ax3_3895,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_etdlibfsueduthesesavailableetd_11152004_195710unrestricted02_las_mainpdf)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2179970:
fof(ax3_3896,axiom,(
    genlmt(c_tptp_member2259_mt,c_basekb) )).

% Cyc Assertion #703194:
fof(ax3_3897,axiom,(
    genlmt(c_terrorisminthemiddleeastfactsheetmt,c_basekb) )).

% Cyc Assertion #1365844:
fof(ax3_3898,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommahtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #2182922:
fof(ax3_3899,axiom,(
    genlmt(c_tptp_member2997_mt,c_basekb) )).

% Cyc Assertion #382936:
fof(ax3_3900,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_continentofsouthamerica))
     => individual(OBJ) ) )).

fof(ax3_3901,axiom,(
    genls(f_residentfn(c_continentofsouthamerica),c_individual) )).

fof(ax3_3902,axiom,(
    ! [OBJ] :
      ( residentfncontinentofsouthamerica(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #189576:
fof(ax3_3903,axiom,(
    genls(c_canonicalizerdirective,c_aspatialinformationstore) )).

fof(ax3_3904,axiom,(
    ! [OBJ] :
      ( canonicalizerdirective(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #874720:
fof(ax3_3905,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtodayinliteraturecombiographyarthurmillerasp)),c_translation_30),c_basekb) )).

% Cyc Assertion #1627610:
fof(ax3_3906,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_abbreviationsvirtualsplatcommeaningmoviesmovies_name_details_tasp)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1066465:
fof(ax3_3907,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid16026)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #614101:
fof(ax3_3908,axiom,(
    genlmt(c_mtforcp_q18,c_basekb) )).

% Cyc Assertion #2053156:
fof(ax3_3909,axiom,(
    genls(c_tptpcol_8_92164,c_tptpcol_7_92163) )).

fof(ax3_3910,axiom,(
    ! [OBJ] :
      ( tptpcol_8_92164(OBJ)
     => tptpcol_7_92163(OBJ) ) )).

% Cyc Assertion #1181895:
fof(ax3_3911,axiom,(
    genls(c_idobject,c_individual) )).

fof(ax3_3912,axiom,(
    ! [OBJ] :
      ( idobject(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #255102:
fof(ax3_3913,axiom,(
    genlmt(c_nationalbriefings_iraqmt,c_hpkbvocabmt) )).

% Cyc Assertion #2175438:
fof(ax3_3914,axiom,(
    genlmt(c_tptp_member1126_mt,c_basekb) )).

% Cyc Assertion #1477272:
fof(ax3_3915,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreenselectcoukvisitoreditorial562html)),c_translation_6),c_basekb) )).

% Cyc Assertion #754957:
fof(ax3_3916,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvillage_idiotsorgmovabletypemt_commentscgientry_id87)),c_translation_32),c_basekb) )).

% Cyc Assertion #854602:
fof(ax3_3917,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdannygoldbergcomabouthtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #2186126:
fof(ax3_3918,axiom,(
    genlmt(c_tptp_member3798_mt,c_basekb) )).

% Cyc Assertion #1377759:
fof(ax3_3919,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetmalaysianpersonchineseperson(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1368385:
fof(ax3_3920,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikihis_girl_friday)),c_translation_28),c_basekb) )).

% Cyc Assertion #2181740:
fof(ax3_3921,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member2701_mt) )).

% Cyc Assertion #859631:
fof(ax3_3922,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_timeline__syria),c_basekb) )).

% Cyc Assertion #1213855:
fof(ax3_3923,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtfhtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #2175746:
fof(ax3_3924,axiom,(
    genlmt(c_tptp_member1203_mt,c_basekb) )).

% Cyc Assertion #880720:
fof(ax3_3925,axiom,(
    genlmt(f_contextofpcwfn(c_foodanddrinktaxonomy),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #1509557:
fof(ax3_3926,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_12),c_basekb) )).

% Cyc Assertion #1610244:
fof(ax3_3927,axiom,(
    genls(c_individual,c_trajector_underspecified) )).

fof(ax3_3928,axiom,(
    ! [OBJ] :
      ( individual(OBJ)
     => trajector_underspecified(OBJ) ) )).

% Cyc Assertion #232671:
fof(ax3_3929,axiom,
    ( mtvisible(c_externalontologyprojectsmt)
   => genls(c_eonodeneedsdeepke,c_aspatialinformationstore) )).

fof(ax3_3930,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_externalontologyprojectsmt)
        & eonodeneedsdeepke(OBJ) )
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #368592:
fof(ax3_3931,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_26),c_basekb) )).

% Cyc Assertion #2173238:
fof(ax3_3932,axiom,(
    genlmt(c_tptp_member576_mt,c_basekb) )).

% Cyc Assertion #1659664:
fof(ax3_3933,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_abbreviationsvirtualsplatcommeaningmoviesmovies_name_details_tasp)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185826:
fof(ax3_3934,axiom,(
    genlmt(c_tptp_member3723_mt,c_basekb) )).

% Cyc Assertion #1594481:
fof(ax3_3935,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_binaryflixcommovieaspscopepid1208)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184442:
fof(ax3_3936,axiom,(
    genlmt(c_tptp_member3377_mt,c_basekb) )).

% Cyc Assertion #244528:
fof(ax3_3937,axiom,(
    genlmt(c_glfgraphforsimplifiedinfectiousdiseaseapmt,c_basekb) )).

% Cyc Assertion #288987:
fof(ax3_3938,axiom,(
    genls(c_eventorroleconcept,c_thing) )).

fof(ax3_3939,axiom,(
    ! [OBJ] :
      ( eventorroleconcept(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1380093:
fof(ax3_3940,axiom,(
    genlmt(c_oastatuscheckermt,c_basekb) )).

% Cyc Assertion #314968:
fof(ax3_3941,axiom,(
    genlmt(c_animalactivitiesvocabularymt,c_basekb) )).

% Cyc Assertion #1038595:
fof(ax3_3942,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_25),c_basekb) )).

% Cyc Assertion #1435141:
fof(ax3_3943,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_9),c_basekb) )).

% Cyc Assertion #2184106:
fof(ax3_3944,axiom,(
    genlmt(c_tptp_member3293_mt,c_basekb) )).

% Cyc Assertion #229515:
fof(ax3_3945,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsdvdfilecomshowthreadphpt16217)),c_translation_32),c_basekb) )).

% Cyc Assertion #1702985:
fof(ax3_3946,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1717888:
fof(ax3_3947,axiom,(
    genlmt(c_lunartopographyvocabularymt,c_basekb) )).

% Cyc Assertion #1404760:
fof(ax3_3948,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_cdi_terrorism_project__in_the_spotlight__asbat_al_ansar_band_of_partisans),c_basekb) )).

% Cyc Assertion #270460:
fof(ax3_3949,axiom,(
    genlmt(c_sensusmappingmt,c_basekb) )).

% Cyc Assertion #1333567:
fof(ax3_3950,axiom,(
    genlmt(c_computerrunningdatamt,c_basekb) )).

% Cyc Assertion #484033:
fof(ax3_3951,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjoint_reviewsgovukassetsdocumentsenglishcardiffreportpdf)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2364350:
fof(ax3_3952,axiom,(
    ! [INS] :
      ( ( mtvisible(c_cyclistsmt)
        & isa(INS,f_unrefinedfn(c_petroleum_crudeoil)) )
     => tptpofobject(INS,f_tptpquantityfn_4(n_209)) ) )).

fof(ax3_3953,axiom,
    ( mtvisible(c_cyclistsmt)
   => relationallinstance(c_tptpofobject,f_unrefinedfn(c_petroleum_crudeoil),f_tptpquantityfn_4(n_209)) )).

% Cyc Assertion #527218:
fof(ax3_3954,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0870541811vglance)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #432748:
fof(ax3_3955,axiom,(
    genls(c_btu_dozerblade,c_partiallytangible) )).

fof(ax3_3956,axiom,(
    ! [OBJ] :
      ( btu_dozerblade(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1571270:
fof(ax3_3957,axiom,(
    genlmt(c_glassboxlogicalschemadescriptionmt,c_basekb) )).

% Cyc Assertion #1328932:
fof(ax3_3958,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetofficebuildinggovernmentalbuilding(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1773168:
fof(ax3_3959,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_ukraine))
     => individual(OBJ) ) )).

fof(ax3_3960,axiom,(
    genls(f_residentfn(c_ukraine),c_individual) )).

fof(ax3_3961,axiom,(
    ! [OBJ] :
      ( residentfnukraine(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1577076:
fof(ax3_3962,axiom,(
    genlmt(c_reasoningaboutreferentrelationsmt,c_basekb) )).

% Cyc Assertion #2183938:
fof(ax3_3963,axiom,(
    genlmt(c_tptp_member3251_mt,c_basekb) )).

% Cyc Assertion #386118:
fof(ax3_3964,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcelebritybookscommerchant2merchantmvcscreenprodproduct_code55005category_codecelebrity_bio)),c_translation_33),c_basekb) )).

% Cyc Assertion #2174394:
fof(ax3_3965,axiom,(
    genlmt(c_tptp_member865_mt,c_basekb) )).

% Cyc Assertion #2181678:
fof(ax3_3966,axiom,(
    genlmt(c_tptp_member2686_mt,c_basekb) )).

% Cyc Assertion #2183446:
fof(ax3_3967,axiom,(
    genlmt(c_tptp_member3128_mt,c_basekb) )).

% Cyc Assertion #986212:
fof(ax3_3968,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_21),c_machinelearningspindleheadmt) )).

% Cyc Assertion #490933:
fof(ax3_3969,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(f_citynamedfn(s_madiyani,c_jammuandkashmir_stateindia)))
     => individual(OBJ) ) )).

fof(ax3_3970,axiom,(
    genls(f_residentfn(f_citynamedfn(s_madiyani,c_jammuandkashmir_stateindia)),c_individual) )).

fof(ax3_3971,axiom,(
    ! [OBJ] :
      ( residentfncitynamedfnmadiyanijammuandkashmir_stateindia(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #914224:
fof(ax3_3972,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineessayscomessaysliteraturelit102php)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2190868:
fof(ax3_3973,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
        & isa(TERM,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)) )
     => tptp_9_51(f_relationexistsallfn(TERM,c_tptp_9_51,c_tptpcol_14_26666,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)),TERM) ) )).

fof(ax3_3974,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => relationexistsall(c_tptp_9_51,c_tptpcol_14_26666,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)) )).

% Cyc Assertion #2183418:
fof(ax3_3975,axiom,(
    genlmt(c_tptp_member3121_mt,c_basekb) )).

% Cyc Assertion #755471:
fof(ax3_3976,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_21),c_basekb) )).

% Cyc Assertion #702965:
fof(ax3_3977,axiom,(
    genlmt(f_contextofpcwfn(c_fivepillarsofislam),c_basekb) )).

% Cyc Assertion #241092:
fof(ax3_3978,axiom,(
    ! [OBJ] :
      ( collectionsubsetfnpartiallytangiblethesetofgiftorisagifthouseplant_pottedisagiftchocolatecandy(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #609257:
fof(ax3_3979,axiom,(
    genlmt(c_patternsofglobalterrorism1997mt,c_currentworlddatacollectormt_nonhomocentric) )).

% Cyc Assertion #2179706:
fof(ax3_3980,axiom,(
    genlmt(c_tptp_member2193_mt,c_basekb) )).

% Cyc Assertion #778268:
fof(ax3_3981,axiom,(
    ! [OBJ] :
      ( collectiondifferencefncollectionowlsemanticdatatype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #351727:
fof(ax3_3982,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_listsibiblioorgpipermailcorpus_paul20030323004209html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #616035:
fof(ax3_3983,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_https_scificomtranscriptsscificon20davisonneumeierhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2177678:
fof(ax3_3984,axiom,(
    genlmt(c_tptp_member1686_mt,c_basekb) )).

% Cyc Assertion #2463177:
fof(ax3_3985,axiom,(
    genls(c_geolevel_4,c_geographicalregion) )).

fof(ax3_3986,axiom,(
    ! [OBJ] :
      ( geolevel_4(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #759527:
fof(ax3_3987,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_filmguardiancoukfeature_storyobserver041202538500html)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1175870:
fof(ax3_3988,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwusatodaycomlifemoviesnews2003_02_04_chicago_xhtm)),c_translation_3),c_basekb) )).

% Cyc Assertion #1869163:
fof(ax3_3989,axiom,(
    genls(c_tptpcol_10_18567,c_tptpcol_9_18439) )).

fof(ax3_3990,axiom,(
    ! [OBJ] :
      ( tptpcol_10_18567(OBJ)
     => tptpcol_9_18439(OBJ) ) )).

% Cyc Assertion #2318181:
fof(ax3_3991,axiom,
    ( mtvisible(c_cyclistsmt)
   => shavingrazor_manual(c_tptpshavingrazor_manual_1) )).

% Cyc Assertion #509349:
fof(ax3_3992,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_driedfn(c_thenchead))
     => partiallytangible(OBJ) ) )).

fof(ax3_3993,axiom,(
    genls(f_driedfn(c_thenchead),c_partiallytangible) )).

fof(ax3_3994,axiom,(
    ! [OBJ] :
      ( driedfnthenchead(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #985332:
fof(ax3_3995,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2481578:
fof(ax3_3996,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x44_y74) )).

% Cyc Assertion #1261749:
fof(ax3_3997,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_marvelsuperheroesmt)
        & isa(OBJ,f_groupfn(c_x_man)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_3998,axiom,
    ( mtvisible(c_marvelsuperheroesmt)
   => genls(f_groupfn(c_x_man),c_partiallytangible) )).

fof(ax3_3999,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_marvelsuperheroesmt)
        & groupfnx_man(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #362057:
fof(ax3_4000,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwreadiocomarchives030205bbroadway5html)),c_translation_31),c_basekb) )).

% Cyc Assertion #2364810:
fof(ax3_4001,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3981_mt)
        & volvopv445car(INS) )
     => tptpofobject(INS,f_tptpquantityfn_0(n_909)) ) )).

fof(ax3_4002,axiom,
    ( mtvisible(c_tptp_member3981_mt)
   => relationallinstance(c_tptpofobject,c_volvopv445car,f_tptpquantityfn_0(n_909)) )).

% Cyc Assertion #1066039:
fof(ax3_4003,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_familyscreensceneallinfoaboutcombioskevin_baconhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #398415:
fof(ax3_4004,axiom,(
    genls(c_12_dimethylhydrazine,c_partiallytangible) )).

fof(ax3_4005,axiom,(
    ! [OBJ] :
      ( tptp_12_dimethylhydrazine(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1444346:
fof(ax3_4006,axiom,(
    genls(c_temporalmicrotheory,c_microtheory) )).

fof(ax3_4007,axiom,(
    ! [OBJ] :
      ( temporalmicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #918478:
fof(ax3_4008,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_bushenyi_districtuganda) )).

% Cyc Assertion #428149:
fof(ax3_4009,axiom,(
    genls(c_pfizergeocillinmarket,c_individual) )).

fof(ax3_4010,axiom,(
    ! [OBJ] :
      ( pfizergeocillinmarket(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1562820:
fof(ax3_4011,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsandrabullockdearticlesdbvanityfair_sep95htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #999768:
fof(ax3_4012,axiom,(
    genlmt(c_iraniansociallifemt,c_worldgeographymt) )).

% Cyc Assertion #1216221:
fof(ax3_4013,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordhitsoffset0)),c_translation_28),c_basekb) )).

% Cyc Assertion #2172951:
fof(ax3_4014,axiom,(
    genlmt(c_tptp_member504_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #454334:
fof(ax3_4015,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccoukhienglishukwalesnewsid_10240001024590stm)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #445171:
fof(ax3_4016,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjfk_onlinecomjfk100bigjimhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2268383:
fof(ax3_4017,axiom,(
    individual(c_tptpcoma) )).

% Cyc Assertion #910279:
fof(ax3_4018,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_32),c_basekb) )).

% Cyc Assertion #729726:
fof(ax3_4019,axiom,(
    genls(c_parkgateway,c_partiallytangible) )).

fof(ax3_4020,axiom,(
    ! [OBJ] :
      ( parkgateway(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1367011:
fof(ax3_4021,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtaorminafilmfestit2003englishawardschedaaspid9)),c_translation_33),c_basekb) )).

% Cyc Assertion #1737186:
fof(ax3_4022,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom2005_07_01_cycledog_archivehtml)),c_translation_29),c_basekb) )).

% Cyc Assertion #2273158:
fof(ax3_4023,axiom,
    ( mtvisible(c_cyclistsmt)
   => audiotapeplaying(c_tptpaudiotapeplaying_4) )).

% Cyc Assertion #174366:
fof(ax3_4024,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_stufffn(f_fruitfn(c_pineappleplant)))
     => partiallytangible(OBJ) ) )).

fof(ax3_4025,axiom,(
    genls(f_stufffn(f_fruitfn(c_pineappleplant)),c_partiallytangible) )).

fof(ax3_4026,axiom,(
    ! [OBJ] :
      ( stufffnfruitfnpineappleplant(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2186054:
fof(ax3_4027,axiom,(
    genlmt(c_tptp_member3780_mt,c_basekb) )).

% Cyc Assertion #1558442:
fof(ax3_4028,axiom,(
    ! [OBJ] :
      ~ ( collection(OBJ)
        & individual(OBJ) ) )).

fof(ax3_4029,axiom,(
    disjointwith(c_collection,c_individual) )).

% Cyc Assertion #1100741:
fof(ax3_4030,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmiamifilmfestivalcomjurorsasp)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1646215:
fof(ax3_4031,axiom,(
    genlmt(c_rockymountaintimezonevocabularymt,c_basekb) )).

% Cyc Assertion #421723:
fof(ax3_4032,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_shootdownisraeliwarplane,c_actiononobject,s_34026920_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_4033,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_shootdownisraeliwarplane,c_actiononobject,s_34026920_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_4034,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternaryshootdownisraeliwarplaneactiononobject34026920_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #448474:
fof(ax3_4035,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadalive_lhtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #461658:
fof(ax3_4036,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_producthalfebaycomthe_great_gatsby_w0qqtgzinfoqqprz11947)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1890045:
fof(ax3_4037,axiom,(
    genls(c_tptpcol_14_26921,c_tptpcol_13_26920) )).

fof(ax3_4038,axiom,(
    ! [OBJ] :
      ( tptpcol_14_26921(OBJ)
     => tptpcol_13_26920(OBJ) ) )).

% Cyc Assertion #829110:
fof(ax3_4039,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrainglecomcommunitywikiphpusergizzerpagejuly)),c_translation_29),c_basekb) )).

% Cyc Assertion #1496780:
fof(ax3_4040,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwzeppscommentariescomvrwcmillerhtm)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175322:
fof(ax3_4041,axiom,(
    genlmt(c_tptp_member1097_mt,c_basekb) )).

% Cyc Assertion #207653:
fof(ax3_4042,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamctvcompersondetailcid8142_1_est)),c_translation_33),c_basekb) )).

% Cyc Assertion #286480:
fof(ax3_4043,axiom,(
    genlmt(c_englishparaphrasemt,c_basekb) )).

% Cyc Assertion #1447974:
fof(ax3_4044,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtvcombackstage_passepisode23169triviahtml)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #459374:
fof(ax3_4045,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #595929:
fof(ax3_4046,axiom,(
    genlmt(c_internationalorganizationdatamt,c_worldgeographydualistmt) )).

% Cyc Assertion #1045612:
fof(ax3_4047,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnvccedualexandriasciencemsdswebcyclohexanolhtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1030169:
fof(ax3_4048,axiom,(
    genls(c_physicsproblem_workenergytheorem,c_individual) )).

fof(ax3_4049,axiom,(
    ! [OBJ] :
      ( physicsproblem_workenergytheorem(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2178422:
fof(ax3_4050,axiom,(
    genlmt(c_tptp_member1872_mt,c_basekb) )).

% Cyc Assertion #1288151:
fof(ax3_4051,axiom,(
    genlmt(c_pq224mt,c_testvocabularymt) )).

% Cyc Assertion #919789:
fof(ax3_4052,axiom,
    ( mtvisible(c_analystdatabasemt)
   => isa(c_secretarygeneral,f_conceptnodesfortasktypefn(c_intelligenceanalysistask_allotment)) )).

fof(ax3_4053,axiom,
    ( mtvisible(c_analystdatabasemt)
   => conceptnodesfortasktypefnintelligenceanalysistask_allotment(c_secretarygeneral) )).

% Cyc Assertion #1469143:
fof(ax3_4054,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0375726721vglance)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #412151:
fof(ax3_4055,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #935446:
fof(ax3_4056,axiom,(
    genlmt(c_miptdatabase19982002_temporarymt,c_ldscgeneralcollectormt) )).

% Cyc Assertion #1634301:
fof(ax3_4057,axiom,(
    genlmt(c_pacifictimezonevocabularymt,c_basekb) )).

% Cyc Assertion #596539:
fof(ax3_4058,axiom,(
    genlmt(c_uppervocabularycollectormt,c_basekb) )).

% Cyc Assertion #1772526:
fof(ax3_4059,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2364805:
fof(ax3_4060,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3630_mt)
        & isa(INS,f_cardealerfn(c_ferraricar)) )
     => tptpofobject(INS,f_tptpquantityfn_9(n_360)) ) )).

fof(ax3_4061,axiom,
    ( mtvisible(c_tptp_member3630_mt)
   => relationallinstance(c_tptpofobject,f_cardealerfn(c_ferraricar),f_tptpquantityfn_9(n_360)) )).

% Cyc Assertion #1739586:
fof(ax3_4062,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_commentcolostateeduindexasppagedisplay_articlearticle_id698743591)),c_translation_0),c_basekb) )).

% Cyc Assertion #2463139:
fof(ax3_4063,axiom,(
    genlmt(c_tptpgeo_spindlecollectormt,c_tptpgeo_member1_mt) )).

% Cyc Assertion #861927:
fof(ax3_4064,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_30),c_basekb) )).

% Cyc Assertion #292594:
fof(ax3_4065,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtopixnetmoviescat_people)),c_translation_28),c_basekb) )).

% Cyc Assertion #165529:
fof(ax3_4066,axiom,(
    genlmt(c_planninggmt,c_basekb) )).

% Cyc Assertion #642373:
fof(ax3_4067,axiom,(
    genlmt(c_knowledgeexchangedatamt,c_basekb) )).

% Cyc Assertion #794085:
fof(ax3_4068,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsermonspluscoukphilippians2013_11htm)),c_translation_32),c_basekb) )).

% Cyc Assertion #1741942:
fof(ax3_4069,axiom,(
    genlmt(c_saicterrorismeventsdatamt,c_basekb) )).

% Cyc Assertion #802563:
fof(ax3_4070,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygvocabularymt)
        & isa(OBJ,f_groupfn(c_chemicalweapon)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_4071,axiom,
    ( mtvisible(c_militarygvocabularymt)
   => genls(f_groupfn(c_chemicalweapon),c_partiallytangible) )).

fof(ax3_4072,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygvocabularymt)
        & groupfnchemicalweapon(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #843600:
fof(ax3_4073,axiom,(
    genlmt(f_contentmtfn(c_fg1_feature_elevation_ks),c_basekb) )).

% Cyc Assertion #1113679:
fof(ax3_4074,axiom,(
    genls(c_defensiveposition,c_partiallytangible) )).

fof(ax3_4075,axiom,(
    ! [OBJ] :
      ( defensiveposition(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2173574:
fof(ax3_4076,axiom,(
    genlmt(c_tptp_member660_mt,c_basekb) )).

% Cyc Assertion #1015570:
fof(ax3_4077,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_productionofartifactfn(c_cocaine))
     => individual(OBJ) ) )).

fof(ax3_4078,axiom,(
    genls(f_productionofartifactfn(c_cocaine),c_individual) )).

fof(ax3_4079,axiom,(
    ! [OBJ] :
      ( productionofartifactfncocaine(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1090653:
fof(ax3_4080,axiom,
    ( mtvisible(c_worldgeographymt)
   => state_geopolitical(c_kalmyk_staterussia) )).

% Cyc Assertion #2178346:
fof(ax3_4081,axiom,(
    genlmt(c_tptp_member1853_mt,c_basekb) )).

% Cyc Assertion #959182:
fof(ax3_4082,axiom,(
    genlmt(c_australasiansociallifemt,c_basekb) )).

% Cyc Assertion #1637769:
fof(ax3_4083,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdiscoverourtowncomtownpagephptown105catattractions)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1318179:
fof(ax3_4084,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2307995:
fof(ax3_4085,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => isa(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_2638,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)) )).

fof(ax3_4086,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => subcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_2638) )).

% Cyc Assertion #174184:
fof(ax3_4087,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpineycomhsmindsphtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1153156:
fof(ax3_4088,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwallaboutmydoccomsurgeonwebsurgeonid2729clinicid1432themetheme4countryuslanguageenpagearticledocid20241)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1889317:
fof(ax3_4089,axiom,(
    genls(c_tptpcol_7_26628,c_tptpcol_6_26627) )).

fof(ax3_4090,axiom,(
    ! [OBJ] :
      ( tptpcol_7_26628(OBJ)
     => tptpcol_6_26627(OBJ) ) )).

% Cyc Assertion #2477533:
fof(ax3_4091,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x11_y25) )).

% Cyc Assertion #155990:
fof(ax3_4092,axiom,(
    genls(c_threateningtodomurderdeviceusedaxe,c_individual) )).

fof(ax3_4093,axiom,(
    ! [OBJ] :
      ( threateningtodomurderdeviceusedaxe(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1558442:
fof(ax3_4094,axiom,(
    ! [OBJ] :
      ~ ( collection(OBJ)
        & individual(OBJ) ) )).

fof(ax3_4095,axiom,(
    disjointwith(c_collection,c_individual) )).

% Cyc Assertion #2176834:
fof(ax3_4096,axiom,(
    genlmt(c_tptp_member1475_mt,c_basekb) )).

% Cyc Assertion #1457346:
fof(ax3_4097,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc33477)),c_translation_25),c_basekb) )).

% Cyc Assertion #1058769:
fof(ax3_4098,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_whatisthecapitalofcomstate_capitalsstate_capitals_tf1html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #212586:
fof(ax3_4099,axiom,
    ( mtvisible(c_externalontologyprojectsmt)
   => genls(c_eonoderawmeaningdefined,c_aspatialinformationstore) )).

fof(ax3_4100,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_externalontologyprojectsmt)
        & eonoderawmeaningdefined(OBJ) )
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #2185334:
fof(ax3_4101,axiom,(
    genlmt(c_tptp_member3600_mt,c_basekb) )).

% Cyc Assertion #1455717:
fof(ax3_4102,axiom,(
    genlmt(f_culturedefinitioncollectormtfn(f_nationalculturefn(c_tunisia)),c_basekb) )).

% Cyc Assertion #758226:
fof(ax3_4103,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsermonspluscoukphilippians2013_11htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #238001:
fof(ax3_4104,axiom,(
    genlmt(c_affectmt,c_basekb) )).

% Cyc Assertion #2181294:
fof(ax3_4105,axiom,(
    genlmt(c_tptp_member2590_mt,c_basekb) )).

% Cyc Assertion #1220761:
fof(ax3_4106,axiom,(
    genls(c_promontory_overland,c_partiallytangible) )).

fof(ax3_4107,axiom,(
    ! [OBJ] :
      ( promontory_overland(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1050323:
fof(ax3_4108,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmastercarsdirectcoukcar_hireusa_sacramentohtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1471569:
fof(ax3_4109,axiom,(
    genlmt(c_alchemycyclisttrainingdatamt,c_basekb) )).

% Cyc Assertion #1347283:
fof(ax3_4110,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richmondthenandnowcomfamous_people_richmond_4html)),c_translation_33),c_basekb) )).

% Cyc Assertion #1598650:
fof(ax3_4111,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmkbmemorialcominterviewsinvitedtalktrans)),c_translation_30),c_basekb) )).

% Cyc Assertion #905279:
fof(ax3_4112,axiom,(
    genlmt(c_metaworldmt,c_worldgeographymt) )).

% Cyc Assertion #1304021:
fof(ax3_4113,axiom,(
    genls(c_eonoderawmeaningdefined,c_aspatialinformationstore) )).

fof(ax3_4114,axiom,(
    ! [OBJ] :
      ( eonoderawmeaningdefined(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #525729:
fof(ax3_4115,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(c_akbuser,c_genericintelligenceanalysis_cae_allotment,c_nooescape_theprogram),c_basekb) )).

% Cyc Assertion #1669859:
fof(ax3_4116,axiom,(
    genlmt(c_moderninternationalrelationsmt,c_basekb) )).

% Cyc Assertion #939665:
fof(ax3_4117,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwavycomglobalstoryasps1775846clienttypeprint)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1109125:
fof(ax3_4118,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrainglecomcommunitywikiphpusergizzerpagejuly)),c_translation_22),c_basekb) )).

% Cyc Assertion #552912:
fof(ax3_4119,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1168057:
fof(ax3_4120,axiom,(
    ! [OBJ] :
      ( collectionintersectionfntheseticecapsummit(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1253251:
fof(ax3_4121,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182947:
fof(ax3_4122,axiom,(
    genlmt(c_tptp_member3003_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #840772:
fof(ax3_4123,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mccchurchorgmncstatement20of20call20to20be20the20next20moderator20of20ufmccdoc)),c_translation_0),c_basekb) )).

% Cyc Assertion #1121527:
fof(ax3_4124,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizjournalscomtriadstories20040105daily32htmljsts_rs_hl)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1717718:
fof(ax3_4125,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(f_territoryfn(c_minnesota_state)))
     => individual(OBJ) ) )).

fof(ax3_4126,axiom,(
    genls(f_residentfn(f_territoryfn(c_minnesota_state)),c_individual) )).

fof(ax3_4127,axiom,(
    ! [OBJ] :
      ( residentfnterritoryfnminnesota_state(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1605314:
fof(ax3_4128,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikiuser_niteowlneilsactors_a_b)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2181554:
fof(ax3_4129,axiom,(
    genlmt(c_tptp_member2655_mt,c_basekb) )).

% Cyc Assertion #1632994:
fof(ax3_4130,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_destroyapassingsecurityvehicle,c_actiononobject,s_340e5002_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_4131,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_destroyapassingsecurityvehicle,c_actiononobject,s_340e5002_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_4132,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarydestroyapassingsecurityvehicleactiononobject340e5002_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #151181:
fof(ax3_4133,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplecchristiedougftppypeoplecchristiedougcanadaright)),c_translation_8),c_basekb) )).

% Cyc Assertion #619018:
fof(ax3_4134,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1393748:
fof(ax3_4135,axiom,(
    genlmt(f_contextofpcwfn(c_fourgospels),c_basekb) )).

% Cyc Assertion #2229620:
fof(ax3_4136,axiom,(
    genlmt(c_theprototypicalapplicationcontext,c_basekb) )).

% Cyc Assertion #2184802:
fof(ax3_4137,axiom,(
    genlmt(c_tptp_member3467_mt,c_basekb) )).

% Cyc Assertion #2174474:
fof(ax3_4138,axiom,(
    genlmt(c_tptp_member885_mt,c_basekb) )).

% Cyc Assertion #1090516:
fof(ax3_4139,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #849389:
fof(ax3_4140,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfredsbibletalkcomfb002html)),c_translation_32),c_basekb) )).

% Cyc Assertion #927285:
fof(ax3_4141,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbiblebelieverscomreagan_tale3citieshtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2178566:
fof(ax3_4142,axiom,(
    genlmt(c_tptp_member1908_mt,c_basekb) )).

% Cyc Assertion #2176714:
fof(ax3_4143,axiom,(
    genlmt(c_tptp_member1445_mt,c_basekb) )).

% Cyc Assertion #2099230:
fof(ax3_4144,axiom,(
    genls(c_tptpcol_5_110593,c_tptpcol_4_106497) )).

fof(ax3_4145,axiom,(
    ! [OBJ] :
      ( tptpcol_5_110593(OBJ)
     => tptpcol_4_106497(OBJ) ) )).

% Cyc Assertion #722358:
fof(ax3_4146,axiom,(
    genlmt(c_jacgeopoliticalissueontologymappingmt,c_basekb) )).

% Cyc Assertion #1230430:
fof(ax3_4147,axiom,(
    genlmt(c_iran_iraqwarmt,c_basekb) )).

% Cyc Assertion #1330586:
fof(ax3_4148,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmark_sheacomchisel_fhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #2174090:
fof(ax3_4149,axiom,(
    genlmt(c_tptp_member789_mt,c_basekb) )).

% Cyc Assertion #602080:
fof(ax3_4150,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhealth_and_fitness_informationcomdiseasesgastroduodenal_crohns_diseasephp)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1683959:
fof(ax3_4151,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_filmguardiancoukfeature_storyobserver041202538500html)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #417031:
fof(ax3_4152,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_b0006gqkbgvglance)),c_translation_33),c_basekb) )).

% Cyc Assertion #538028:
fof(ax3_4153,axiom,(
    genls(c_overlappreservingprojection,c_individual) )).

fof(ax3_4154,axiom,(
    ! [OBJ] :
      ( overlappreservingprojection(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #978416:
fof(ax3_4155,axiom,(
    individual(c_communitysavingsbanksharesinc) )).

% Cyc Assertion #1889319:
fof(ax3_4156,axiom,(
    genls(c_tptpcol_8_26629,c_tptpcol_7_26628) )).

fof(ax3_4157,axiom,(
    ! [OBJ] :
      ( tptpcol_8_26629(OBJ)
     => tptpcol_7_26628(OBJ) ) )).

% Cyc Assertion #1493105:
fof(ax3_4158,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_specificationtypefromparametertypefn(c_nlparsingparameter))
     => individual(OBJ) ) )).

fof(ax3_4159,axiom,(
    genls(f_specificationtypefromparametertypefn(c_nlparsingparameter),c_individual) )).

fof(ax3_4160,axiom,(
    ! [OBJ] :
      ( specificationtypefromparametertypefnnlparsingparameter(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #964636:
fof(ax3_4161,axiom,(
    genlmt(c_generalenglishmt,c_basekb) )).

% Cyc Assertion #1648213:
fof(ax3_4162,axiom,(
    genls(c_lottery649_nationallottery,c_individual) )).

fof(ax3_4163,axiom,(
    ! [OBJ] :
      ( lottery649_nationallottery(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1496172:
fof(ax3_4164,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_intermittentbodyofwaterfn(c_waterreservoir))
     => partiallytangible(OBJ) ) )).

fof(ax3_4165,axiom,(
    genls(f_intermittentbodyofwaterfn(c_waterreservoir),c_partiallytangible) )).

fof(ax3_4166,axiom,(
    ! [OBJ] :
      ( intermittentbodyofwaterfnwaterreservoir(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2176402:
fof(ax3_4167,axiom,(
    genlmt(c_tptp_member1367_mt,c_basekb) )).

% Cyc Assertion #2182782:
fof(ax3_4168,axiom,(
    genlmt(c_tptp_member2962_mt,c_basekb) )).

% Cyc Assertion #1517166:
fof(ax3_4169,axiom,(
    arg2isa(c_softwareparametervaluedomaininsoftwareobject,c_setorcollection) )).

fof(ax3_4170,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( softwareparametervaluedomaininsoftwareobject(ARG1,ARG2,ARG3)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #206719:
fof(ax3_4171,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwajrorgarticleaspid750)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172678:
fof(ax3_4172,axiom,(
    genlmt(c_tptp_member436_mt,c_basekb) )).

% Cyc Assertion #507209:
fof(ax3_4173,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtrikiwikicomgarry_marshall)),c_translation_29),c_basekb) )).

% Cyc Assertion #142859:
fof(ax3_4174,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_librarythinkquestorg23846librarynovelsjaneeyre_01_novhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1091788:
fof(ax3_4175,axiom,(
    genls(c_cycorprootallotment,c_individual) )).

fof(ax3_4176,axiom,(
    ! [OBJ] :
      ( cycorprootallotment(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2175562:
fof(ax3_4177,axiom,(
    genlmt(c_tptp_member1157_mt,c_basekb) )).

% Cyc Assertion #1308211:
fof(ax3_4178,axiom,(
    genlmt(c_newtonianphysicsspindleheadmt,c_basekb) )).

% Cyc Assertion #322072:
fof(ax3_4179,axiom,(
    genlpreds(c_extent,c_subsetof) )).

fof(ax3_4180,axiom,(
    ! [ARG1,ARG2] :
      ( extent(ARG1,ARG2)
     => subsetof(ARG1,ARG2) ) )).

% Cyc Assertion #1045973:
fof(ax3_4181,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvolumenycorgarticle_detailindexaspid151sectionwork)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1164870:
fof(ax3_4182,axiom,(
    genls(c_siblingvarianthypothesizingrule,c_individual) )).

fof(ax3_4183,axiom,(
    ! [OBJ] :
      ( siblingvarianthypothesizingrule(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1011720:
fof(ax3_4184,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsawncomindexphpltypecatcategory1filmsnewsitem_no11515dir1)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #301950:
fof(ax3_4185,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmedscapecomviewarticle479012_4)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1198788:
fof(ax3_4186,axiom,(
    genls(c_connectedphysicalpathsystem,c_partiallytangible) )).

fof(ax3_4187,axiom,(
    ! [OBJ] :
      ( connectedphysicalpathsystem(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1419068:
fof(ax3_4188,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_industryinfrastructurereqfn(c_oilindustry))
     => partiallytangible(OBJ) ) )).

fof(ax3_4189,axiom,(
    genls(f_industryinfrastructurereqfn(c_oilindustry),c_partiallytangible) )).

fof(ax3_4190,axiom,(
    ! [OBJ] :
      ( industryinfrastructurereqfnoilindustry(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2183314:
fof(ax3_4191,axiom,(
    genlmt(c_tptp_member3095_mt,c_basekb) )).

% Cyc Assertion #580386:
fof(ax3_4192,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_21),c_machinelearningspindleheadmt) )).

% Cyc Assertion #318257:
fof(ax3_4193,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsearchspanielcomindexphptitlemeaslesprintableyes)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2179070:
fof(ax3_4194,axiom,(
    genlmt(c_tptp_member2034_mt,c_basekb) )).

% Cyc Assertion #673769:
fof(ax3_4195,axiom,(
    genlmt(c_womansittinginstreamimt,c_basekb) )).

% Cyc Assertion #1705510:
fof(ax3_4196,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsaramacomforumsshowthreadphpthreadid35479)),c_translation_28),c_basekb) )).

% Cyc Assertion #434166:
fof(ax3_4197,axiom,(
    genls(c_paraformaldehyde,c_partiallytangible) )).

fof(ax3_4198,axiom,(
    ! [OBJ] :
      ( paraformaldehyde(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2176066:
fof(ax3_4199,axiom,(
    genlmt(c_tptp_member1283_mt,c_basekb) )).

% Cyc Assertion #741942:
fof(ax3_4200,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_25),c_basekb) )).

% Cyc Assertion #515238:
fof(ax3_4201,axiom,(
    genls(c_cyclassertiondirection,c_collection) )).

fof(ax3_4202,axiom,(
    ! [OBJ] :
      ( cyclassertiondirection(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1769327:
fof(ax3_4203,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwprowhointhealth_topicsdiphtheria)),c_translation_33),c_basekb) )).

% Cyc Assertion #1331020:
fof(ax3_4204,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmumbai_centralcomnukkadjan2002msg00287html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1238004:
fof(ax3_4205,axiom,(
    genls(c_kbcontenttestforaquaintkbpiloteval_fromatm,c_individual) )).

fof(ax3_4206,axiom,(
    ! [OBJ] :
      ( kbcontenttestforaquaintkbpiloteval_fromatm(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #883199:
fof(ax3_4207,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_atlantaindymediaorgnewswiredisplay19045)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1752192:
fof(ax3_4208,axiom,(
    genlmt(c_pq76mt,c_basekb) )).

% Cyc Assertion #1158059:
fof(ax3_4209,axiom,(
    genls(c_store_generic,c_partiallytangible) )).

fof(ax3_4210,axiom,(
    ! [OBJ] :
      ( store_generic(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #426529:
fof(ax3_4211,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvdplayerreviewsnetitemsb0000cbl7a)),c_translation_28),c_basekb) )).

% Cyc Assertion #2186502:
fof(ax3_4212,axiom,(
    genlmt(c_tptp_member3892_mt,c_basekb) )).

% Cyc Assertion #1277092:
fof(ax3_4213,axiom,(
    genlmt(c_thekennelclubukmt,c_basekb) )).

% Cyc Assertion #949267:
fof(ax3_4214,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172250:
fof(ax3_4215,axiom,(
    genlmt(c_tptp_member329_mt,c_basekb) )).

% Cyc Assertion #741701:
fof(ax3_4216,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasgcomnewsroompr_detailsaspid156)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1481113:
fof(ax3_4217,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic2418494viewnew)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #835181:
fof(ax3_4218,axiom,(
    genlmt(c_tkbinterestingnessrulesmt,c_worldgeographydualistmt) )).

% Cyc Assertion #1135842:
fof(ax3_4219,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoscgovoncaregulationorders2001ord_20010831_2111_elliotandpagejsp)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2151061:
fof(ax3_4220,axiom,(
    arg2isa(c_tptptypes_8_89,c_firstordercollection) )).

fof(ax3_4221,axiom,(
    ! [ARG1,ARG2] :
      ( tptptypes_8_89(ARG1,ARG2)
     => firstordercollection(ARG2) ) )).

% Cyc Assertion #260338:
fof(ax3_4222,axiom,(
    genls(c_inorganicsoilregion,c_geographicalregion) )).

fof(ax3_4223,axiom,(
    ! [OBJ] :
      ( inorganicsoilregion(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #278674:
fof(ax3_4224,axiom,(
    genls(c_wiseusemovement,c_individual) )).

fof(ax3_4225,axiom,(
    ! [OBJ] :
      ( wiseusemovement(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #581350:
fof(ax3_4226,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_hezbollah__a_chapter_from_funding_evil),c_basekb) )).

% Cyc Assertion #616823:
fof(ax3_4227,axiom,(
    genls(c_molecularconfiguration,c_individual) )).

fof(ax3_4228,axiom,(
    ! [OBJ] :
      ( molecularconfiguration(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1429718:
fof(ax3_4229,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordtrueliesoffset0)),c_translation_31),c_basekb) )).

% Cyc Assertion #1017957:
fof(ax3_4230,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmtsuedusocworkfrostgodmohicanshtm)),c_translation_1),c_basekb) )).

% Cyc Assertion #1446258:
fof(ax3_4231,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwabsoluteastronomycomencyclopediammimichael_douglashtm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #564485:
fof(ax3_4232,axiom,(
    physicalorderingpredicate(c_southof) )).

% Cyc Assertion #358457:
fof(ax3_4233,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsusmsorgshowthreadphps7f6b0d46156934cb7644d098446d30bfthreadid2363)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #929016:
fof(ax3_4234,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_accessoryfn_activity(c_martialartsactivity_asian))
     => artifact(OBJ) ) )).

fof(ax3_4235,axiom,(
    genls(f_accessoryfn_activity(c_martialartsactivity_asian),c_artifact) )).

fof(ax3_4236,axiom,(
    ! [OBJ] :
      ( accessoryfn_activitymartialartsactivity_asian(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #141927:
fof(ax3_4237,axiom,(
    genlmt(c_religiouspeopledatamt,c_basekb) )).

% Cyc Assertion #555111:
fof(ax3_4238,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomresearchtrianglelab4191millermillershtml)),c_translation_27),c_basekb) )).

% Cyc Assertion #2178938:
fof(ax3_4239,axiom,(
    genlmt(c_tptp_member2001_mt,c_basekb) )).

% Cyc Assertion #651461:
fof(ax3_4240,axiom,(
    applicationcontext(c_imsmo_sppdatamt) )).

% Cyc Assertion #2172418:
fof(ax3_4241,axiom,(
    genlmt(c_tptp_member371_mt,c_basekb) )).

% Cyc Assertion #1312087:
fof(ax3_4242,axiom,(
    genlmt(c_pq226mt,c_testvocabularymt) )).

% Cyc Assertion #861432:
fof(ax3_4243,axiom,(
    genlmt(c_metavillemt,c_basekb) )).

% Cyc Assertion #554704:
fof(ax3_4244,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjerrylentzcomarchive2003_06_01_archivehtml)),c_translation_27),c_basekb) )).

% Cyc Assertion #241659:
fof(ax3_4245,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1427572:
fof(ax3_4246,axiom,(
    genls(c_pascalcpspecificationmt,c_microtheory) )).

fof(ax3_4247,axiom,(
    ! [OBJ] :
      ( pascalcpspecificationmt(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #1449534:
fof(ax3_4248,axiom,(
    genlmt(c_cycorpagentsmt,c_cyclistsmt) )).

% Cyc Assertion #554882:
fof(ax3_4249,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_21),c_basekb) )).

% Cyc Assertion #836325:
fof(ax3_4250,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_11),c_basekb) )).

% Cyc Assertion #2179258:
fof(ax3_4251,axiom,(
    genlmt(c_tptp_member2081_mt,c_basekb) )).

% Cyc Assertion #467781:
fof(ax3_4252,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_13),c_basekb) )).

% Cyc Assertion #2176122:
fof(ax3_4253,axiom,(
    genlmt(c_tptp_member1297_mt,c_basekb) )).

% Cyc Assertion #2172014:
fof(ax3_4254,axiom,(
    genlmt(c_tptp_member270_mt,c_basekb) )).

% Cyc Assertion #1220966:
fof(ax3_4255,axiom,(
    genls(c_russianclosednuclearcity,c_individual) )).

fof(ax3_4256,axiom,(
    ! [OBJ] :
      ( russianclosednuclearcity(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #150198:
fof(ax3_4257,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpineycomhsmindsphtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #476647:
fof(ax3_4258,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovienavigatororgdigitalragehtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #2184790:
fof(ax3_4259,axiom,(
    genlmt(c_tptp_member3464_mt,c_basekb) )).

% Cyc Assertion #963950:
fof(ax3_4260,axiom,(
    genlmt(c_waarmoredtempmt,c_basekb) )).

% Cyc Assertion #1342842:
fof(ax3_4261,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_united_nations),c_ldscgeneralcollectormt) )).

% Cyc Assertion #172196:
fof(ax3_4262,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviehabitcomessayscoffee_talk_04shtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #443460:
fof(ax3_4263,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_qa3724is_200209ai_n9094343)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #919564:
fof(ax3_4264,axiom,(
    genlmt(c_unixscriptinglanguagemt,c_basekb) )).

% Cyc Assertion #2179344:
fof(ax3_4265,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member2102_mt) )).

% Cyc Assertion #833751:
fof(ax3_4266,axiom,(
    genls(c_computerdataartifact,c_artifact) )).

fof(ax3_4267,axiom,(
    ! [OBJ] :
      ( computerdataartifact(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1734106:
fof(ax3_4268,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_minute_by_minute_account),c_basekb) )).

% Cyc Assertion #1532958:
fof(ax3_4269,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_14),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1677062:
fof(ax3_4270,axiom,(
    genlmt(c_pq5_6_87_97mt,c_basekb) )).

% Cyc Assertion #878058:
fof(ax3_4271,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_moneycnncommagazinesfortunefortune_archive200512128363101)),c_translation_29),c_basekb) )).

% Cyc Assertion #1286559:
fof(ax3_4272,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_qa3849is_199905ai_n8849340)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1736201:
fof(ax3_4273,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1013316:
fof(ax3_4274,axiom,(
    genlmt(c_ilpmode_experimentalrulesmt,c_basekb) )).

% Cyc Assertion #782534:
fof(ax3_4275,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtheologyeduntintrogalhtm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #518899:
fof(ax3_4276,axiom,(
    genls(c_y2stage3_desiredresourcefromiran,c_individual) )).

fof(ax3_4277,axiom,(
    ! [OBJ] :
      ( y2stage3_desiredresourcefromiran(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1307189:
fof(ax3_4278,axiom,(
    genls(c_adjptemplate_predicative,c_individual) )).

fof(ax3_4279,axiom,(
    ! [OBJ] :
      ( adjptemplate_predicative(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2178178:
fof(ax3_4280,axiom,(
    genlmt(c_tptp_member1811_mt,c_basekb) )).

% Cyc Assertion #2175774:
fof(ax3_4281,axiom,(
    genlmt(c_tptp_member1210_mt,c_basekb) )).

% Cyc Assertion #1769447:
fof(ax3_4282,axiom,(
    transitivebinarypredicate(c_rewriteof) )).

% Cyc Assertion #2172735:
fof(ax3_4283,axiom,(
    genlmt(c_tptp_member450_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1293657:
fof(ax3_4284,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpeoplememphisedudwnickls3790rfp_sp05htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1603428:
fof(ax3_4285,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetdeformablefluidtangiblething(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2199502:
fof(ax3_4286,axiom,(
    genlmt(c_tptpnlexiconextensionhypothesismttypeforlanguagefnamericanenglishdialect,c_basekb) )).

% Cyc Assertion #1737408:
fof(ax3_4287,axiom,(
    genls(c_pfizerdiabinesemarket,c_individual) )).

fof(ax3_4288,axiom,(
    ! [OBJ] :
      ( pfizerdiabinesemarket(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1045782:
fof(ax3_4289,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic3113018)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1455718:
fof(ax3_4290,axiom,(
    genls(c_keyring,c_artifact) )).

fof(ax3_4291,axiom,(
    ! [OBJ] :
      ( keyring(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #343590:
fof(ax3_4292,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richlabontenetexonewsxtra3strange_quarkshtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #2182722:
fof(ax3_4293,axiom,(
    genlmt(c_tptp_member2947_mt,c_basekb) )).

% Cyc Assertion #605502:
fof(ax3_4294,axiom,(
    genls(c_knownhostileactivity,c_geographicalregion) )).

fof(ax3_4295,axiom,(
    ! [OBJ] :
      ( knownhostileactivity(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1529000:
fof(ax3_4296,axiom,(
    genls(c_geographicalfootprint,c_individual) )).

fof(ax3_4297,axiom,(
    ! [OBJ] :
      ( geographicalfootprint(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #708321:
fof(ax3_4298,axiom,(
    arg2isa(c_cblpostcondition,c_cblmust) )).

fof(ax3_4299,axiom,(
    ! [ARG1,ARG2] :
      ( cblpostcondition(ARG1,ARG2)
     => cblmust(ARG2) ) )).

% Cyc Assertion #1568850:
fof(ax3_4300,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnpgorguklivesearchpersonasplinkidmp05622)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2180038:
fof(ax3_4301,axiom,(
    genlmt(c_tptp_member2276_mt,c_basekb) )).

% Cyc Assertion #1181429:
fof(ax3_4302,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmbugcoukdb293_9)),c_translation_30),c_basekb) )).

% Cyc Assertion #2341860:
fof(ax3_4303,axiom,(
    isa(c_tptpnsubcollectionofwithrelationtotypefnissuingaprescriptionproductscorrectivelensprescription_2804,f_subcollectionofwithrelationtotypefn(c_issuingaprescription,c_products,c_correctivelensprescription)) )).

fof(ax3_4304,axiom,(
    subcollectionofwithrelationtotypefnissuingaprescriptionproductscorrectivelensprescription(c_tptpnsubcollectionofwithrelationtotypefnissuingaprescriptionproductscorrectivelensprescription_2804) )).

% Cyc Assertion #2186198:
fof(ax3_4305,axiom,(
    genlmt(c_tptp_member3816_mt,c_basekb) )).

% Cyc Assertion #908771:
fof(ax3_4306,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_artsedgekennedy_centerorgcontent3498)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #784541:
fof(ax3_4307,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleaderucomtheologyteenwitchcrafthtml)),c_translation_14),c_basekb) )).

% Cyc Assertion #2179118:
fof(ax3_4308,axiom,(
    genlmt(c_tptp_member2046_mt,c_basekb) )).

% Cyc Assertion #1633923:
fof(ax3_4309,axiom,(
    genlmt(c_aspecttense_logicmt,c_basekb) )).

% Cyc Assertion #1803537:
fof(ax3_4310,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwarthritisremediesorg)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #445554:
fof(ax3_4311,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwblurtycomuserslynnettelai)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #303964:
fof(ax3_4312,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpproductcustomer_reviews0679727299)),c_translation_33),c_basekb) )).

% Cyc Assertion #428432:
fof(ax3_4313,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkentuckycommldheraldleadersports6546184htm)),c_translation_31),c_basekb) )).

% Cyc Assertion #1559833:
fof(ax3_4314,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplewwaynelindacanadaright)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #603591:
fof(ax3_4315,axiom,(
    genlmt(c_cycsecuretestplanningdomainmt,c_basekb) )).

% Cyc Assertion #944999:
fof(ax3_4316,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_accessoryfn_activity(c_weddingevent_generic))
     => artifact(OBJ) ) )).

fof(ax3_4317,axiom,(
    genls(f_accessoryfn_activity(c_weddingevent_generic),c_artifact) )).

fof(ax3_4318,axiom,(
    ! [OBJ] :
      ( accessoryfn_activityweddingevent_generic(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #151856:
fof(ax3_4319,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrediffcomnews1999apr30keralhtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1553728:
fof(ax3_4320,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic2418494viewnew)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2176956:
fof(ax3_4321,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member1505_mt) )).

% Cyc Assertion #2183286:
fof(ax3_4322,axiom,(
    genlmt(c_tptp_member3088_mt,c_basekb) )).

% Cyc Assertion #1742810:
fof(ax3_4323,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplewwaynelindacanadaright)),c_translation_8),c_basekb) )).

% Cyc Assertion #2173398:
fof(ax3_4324,axiom,(
    genlmt(c_tptp_member616_mt,c_basekb) )).

% Cyc Assertion #1498706:
fof(ax3_4325,axiom,(
    genlmt(c_dod_certcomputervulnerabilitydatamt,c_basekb) )).

% Cyc Assertion #1281423:
fof(ax3_4326,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archivestcmieirishexaminer20000826currentfpage_7htm)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1591003:
fof(ax3_4327,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfirstbaptistlafayetteorgser111305htm)),c_translation_32),c_basekb) )).

% Cyc Assertion #2118034:
fof(ax3_4328,axiom,(
    genls(c_tptpcol_13_118117,c_tptpcol_12_118116) )).

fof(ax3_4329,axiom,(
    ! [OBJ] :
      ( tptpcol_13_118117(OBJ)
     => tptpcol_12_118116(OBJ) ) )).

% Cyc Assertion #2177103:
fof(ax3_4330,axiom,(
    genlmt(c_tptp_member1542_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #421796:
fof(ax3_4331,axiom,(
    genlmt(c_auxinversiontemplatemt,c_basekb) )).

% Cyc Assertion #818270:
fof(ax3_4332,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_moneycnncommagazinesfortunefortune_archive200512128363101)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1133053:
fof(ax3_4333,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhmcpsuedugiresearchfacultyouyanghtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #1656737:
fof(ax3_4334,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeorgiamonthlycomfestivaloftreeshtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #328902:
fof(ax3_4335,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromfn(c_personwithoccupation,c_performsinstancesaspartofjob,f_subcollectionofwithrelationtofn(c_guardingsomething,c_objectguarded,c_forest)))
     => partiallytangible(OBJ) ) )).

fof(ax3_4336,axiom,(
    genls(f_subcollectionofwithrelationfromfn(c_personwithoccupation,c_performsinstancesaspartofjob,f_subcollectionofwithrelationtofn(c_guardingsomething,c_objectguarded,c_forest)),c_partiallytangible) )).

fof(ax3_4337,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromfnpersonwithoccupationperformsinstancesaspartofjobsubcollectionofwithrelationtofnguardingsomethingobjectguardedforest(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1228768:
fof(ax3_4338,axiom,(
    genlmt(c_knowledgefragmentc6mt,c_basekb) )).

% Cyc Assertion #1214449:
fof(ax3_4339,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_ww2moviefreebiecom_8567moviessome20folks20call20it20a20sling20bladeasb00005uo7f)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2365406:
fof(ax3_4340,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_spindleheadmt)
        & taxicab(INS) )
     => tptpofobject(INS,f_tptpquantityfn_17(n_79)) ) )).

fof(ax3_4341,axiom,
    ( mtvisible(c_tptp_spindleheadmt)
   => relationallinstance(c_tptpofobject,c_taxicab,f_tptpquantityfn_17(n_79)) )).

% Cyc Assertion #842208:
fof(ax3_4342,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_moneycnncommagazinesfortunefortune_archive200512128363101)),c_translation_30),c_basekb) )).

% Cyc Assertion #1799311:
fof(ax3_4343,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwterminalcitycaindexphpoptioncom_contenttaskviewid100itemid33)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #973400:
fof(ax3_4344,axiom,(
    genlmt(c_wamt_evalinitial_p11a,c_basekb) )).

% Cyc Assertion #299359:
fof(ax3_4345,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_canelonesdepartmenturuguay) )).

% Cyc Assertion #2179734:
fof(ax3_4346,axiom,(
    genlmt(c_tptp_member2200_mt,c_basekb) )).

% Cyc Assertion #1863721:
fof(ax3_4347,axiom,(
    genls(c_tptpcol_6_16389,c_tptpcol_5_16388) )).

fof(ax3_4348,axiom,(
    ! [OBJ] :
      ( tptpcol_6_16389(OBJ)
     => tptpcol_5_16388(OBJ) ) )).

% Cyc Assertion #2499616:
fof(ax3_4349,axiom,
    ( mtvisible(c_tptpgeo_member3_mt)
   => inregion(c_geolocation_x14_y39,c_georegion_l4_x14_y39) )).

% Cyc Assertion #1691145:
fof(ax3_4350,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_24),c_basekb) )).

% Cyc Assertion #398814:
fof(ax3_4351,axiom,(
    ! [OBJ,COL1,COL2] :
      ~ ( isa(OBJ,COL1)
        & isa(OBJ,COL2)
        & disjointwith(COL1,COL2) ) )).

% Cyc Assertion #1845920:
fof(ax3_4352,axiom,(
    firstordercollection(c_tptpcol_16_9272) )).

% Cyc Assertion #2174734:
fof(ax3_4353,axiom,(
    genlmt(c_tptp_member950_mt,c_basekb) )).

% Cyc Assertion #656177:
fof(ax3_4354,axiom,(
    genlmt(c_humanactivitieswithbrandnamescollectormt,c_basekb) )).

% Cyc Assertion #1757870:
fof(ax3_4355,axiom,(
    genlmt(c_uia_worldleaders_demoenvironmentmt,c_humansociallifemt) )).

% Cyc Assertion #2176922:
fof(ax3_4356,axiom,(
    genlmt(c_tptp_member1497_mt,c_basekb) )).

% Cyc Assertion #1922596:
fof(ax3_4357,axiom,(
    genls(c_tptpcol_8_39940,c_tptpcol_7_39939) )).

fof(ax3_4358,axiom,(
    ! [OBJ] :
      ( tptpcol_8_39940(OBJ)
     => tptpcol_7_39939(OBJ) ) )).

% Cyc Assertion #2176470:
fof(ax3_4359,axiom,(
    genlmt(c_tptp_member1384_mt,c_basekb) )).

% Cyc Assertion #975293:
fof(ax3_4360,axiom,(
    arg2isa(c_tangiblethreattypeposed,c_temporalstufftype) )).

fof(ax3_4361,axiom,(
    ! [ARG1,ARG2] :
      ( tangiblethreattypeposed(ARG1,ARG2)
     => temporalstufftype(ARG2) ) )).

% Cyc Assertion #981698:
fof(ax3_4362,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwclubmomcomjforumpostslist195142052page)),c_translation_33),c_basekb) )).

% Cyc Assertion #1398280:
fof(ax3_4363,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom200507our_fordhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #2182150:
fof(ax3_4364,axiom,(
    genlmt(c_tptp_member2804_mt,c_basekb) )).

% Cyc Assertion #649302:
fof(ax3_4365,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhsbrnetdiscussionwatercooler2000060701hsbr)),c_translation_2),c_basekb) )).

% Cyc Assertion #1320172:
fof(ax3_4366,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpoweripodsearchinfobrown_ipodhtml)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #1744179:
fof(ax3_4367,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinwapcommfactorshtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1630316:
fof(ax3_4368,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamericanpoemscom6304524005some_folks_call_it_a_sling_bladephp)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1574834:
fof(ax3_4369,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsandrabullockdearticlesdbvanityfair_sep95htm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #968595:
fof(ax3_4370,axiom,(
    individual(f_citynamedfn(s_nanki_shirahama,c_japan)) )).

% Cyc Assertion #518136:
fof(ax3_4371,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_1893224244vglance)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2179926:
fof(ax3_4372,axiom,(
    genlmt(c_tptp_member2248_mt,c_basekb) )).

% Cyc Assertion #942656:
fof(ax3_4373,axiom,(
    genls(c_limping,c_individual) )).

fof(ax3_4374,axiom,(
    ! [OBJ] :
      ( limping(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #247296:
fof(ax3_4375,axiom,(
    genlmt(c_rkfroyaltyridgegisworkaroundmt,c_basekb) )).

% Cyc Assertion #1186030:
fof(ax3_4376,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_personwithoccupation,c_domainsofspecialization,c_artifact_communication))
     => partiallytangible(OBJ) ) )).

fof(ax3_4377,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_personwithoccupation,c_domainsofspecialization,c_artifact_communication),c_partiallytangible) )).

fof(ax3_4378,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnpersonwithoccupationdomainsofspecializationartifact_communication(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1741800:
fof(ax3_4379,axiom,(
    genlmt(f_lexicalmtforlanguagefn(c_arabiclanguage),c_basekb) )).

% Cyc Assertion #1326311:
fof(ax3_4380,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1129245344)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1063147:
fof(ax3_4381,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_joyfulmusictripodcompage4html)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #587314:
fof(ax3_4382,axiom,(
    genlmt(c_spatialgvocabularymt,c_basekb) )).

% Cyc Assertion #1278956:
fof(ax3_4383,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_joyfulmusictripodcompage4html)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2186202:
fof(ax3_4384,axiom,(
    genlmt(c_tptp_member3817_mt,c_basekb) )).

% Cyc Assertion #598385:
fof(ax3_4385,axiom,(
    genlmt(c_cycsecureapplicationmt,c_basekb) )).

% Cyc Assertion #1294478:
fof(ax3_4386,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthedailybulletincompostcardsmar9chtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182874:
fof(ax3_4387,axiom,(
    genlmt(c_tptp_member2985_mt,c_basekb) )).

% Cyc Assertion #909490:
fof(ax3_4388,axiom,(
    genlmt(f_contextofpcwfn(c_alcoholnotappropriategift),c_humansociallifemt) )).

% Cyc Assertion #449135:
fof(ax3_4389,axiom,(
    genls(c_ebmt_englishtocycl,c_individual) )).

fof(ax3_4390,axiom,(
    ! [OBJ] :
      ( ebmt_englishtocycl(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1125877:
fof(ax3_4391,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic3113018)),c_translation_0),c_basekb) )).

% Cyc Assertion #842678:
fof(ax3_4392,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_qa3817is_199812ai_n8810013)),c_translation_32),c_basekb) )).

% Cyc Assertion #878216:
fof(ax3_4393,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwonlineessayscomessaysliteraturelit102php)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1527835:
fof(ax3_4394,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetabandoned_existentialstatusbuildingcluster(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #602886:
fof(ax3_4395,axiom,(
    genls(c_cycinternaltask_researchcyc_project_the_46,c_individual) )).

fof(ax3_4396,axiom,(
    ! [OBJ] :
      ( cycinternaltask_researchcyc_project_the_46(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1002516:
fof(ax3_4397,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetzoominginonsomethingzoomingoutonsomething(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #903303:
fof(ax3_4398,axiom,(
    genlmt(c_pharmaceuticalusemt,c_basekb) )).

% Cyc Assertion #2375623:
fof(ax3_4399,axiom,(
    individual(c_tptppontiact1000car_6) )).

% Cyc Assertion #445962:
fof(ax3_4400,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetfoggyareamistyareamoderatebreezearealightsnowarea(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1519383:
fof(ax3_4401,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_richmondthenandnowcomfamous_people_richmond_4html)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1712251:
fof(ax3_4402,axiom,(
    genlmt(f_contentmtheadfn(c_wordnet2_0_ks),c_basekb) )).

% Cyc Assertion #779563:
fof(ax3_4403,axiom,(
    genlmt(c_ciaworldfactbook1995mt,c_organizationdatamt) )).

% Cyc Assertion #1307869:
fof(ax3_4404,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordhitsoffset0)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #576758:
fof(ax3_4405,axiom,(
    genls(c_computerdataartifact,c_somethingexisting) )).

fof(ax3_4406,axiom,(
    ! [OBJ] :
      ( computerdataartifact(OBJ)
     => somethingexisting(OBJ) ) )).

% Cyc Assertion #673630:
fof(ax3_4407,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlazymoviecriticcomarchives2004sep000307php)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1577118:
fof(ax3_4408,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpineycomfatchryshomixcolhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #492392:
fof(ax3_4409,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjudygarlandoffset0)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1268926:
fof(ax3_4410,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombauniversity,c_actiononobject,s_33f68241_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_4411,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombauniversity,c_actiononobject,s_33f68241_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_4412,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarybombauniversityactiononobject33f68241_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2182494:
fof(ax3_4413,axiom,(
    genlmt(c_tptp_member2890_mt,c_basekb) )).

% Cyc Assertion #1762199:
fof(ax3_4414,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinfidelsorglibrarymodernfarrell_tillgeisler_tillgeisler1html)),c_translation_32),c_basekb) )).

% Cyc Assertion #2181828:
fof(ax3_4415,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member2723_mt) )).

% Cyc Assertion #1105463:
fof(ax3_4416,axiom,(
    genlmt(f_contextofpcwfn(c_proceedings_of_the_13th_world_wide_web_conference),c_basekb) )).

% Cyc Assertion #1639598:
fof(ax3_4417,axiom,(
    genls(c_enduringthing_localized,c_spatialthing_nonsituational) )).

fof(ax3_4418,axiom,(
    ! [OBJ] :
      ( enduringthing_localized(OBJ)
     => spatialthing_nonsituational(OBJ) ) )).

% Cyc Assertion #2184022:
fof(ax3_4419,axiom,(
    genlmt(c_tptp_member3272_mt,c_basekb) )).

% Cyc Assertion #2171374:
fof(ax3_4420,axiom,(
    genlmt(c_tptp_member110_mt,c_basekb) )).

% Cyc Assertion #493876:
fof(ax3_4421,axiom,(
    genlmt(c_imsmo_xrdatamt,c_basekb) )).

% Cyc Assertion #2361468:
fof(ax3_4422,axiom,(
    ! [INS] :
      ( ( mtvisible(c_cyclistsmt)
        & pencap(INS) )
     => tptpofobject(INS,f_tptpquantityfn_10(n_695)) ) )).

fof(ax3_4423,axiom,
    ( mtvisible(c_cyclistsmt)
   => relationallinstance(c_tptpofobject,c_pencap,f_tptpquantityfn_10(n_695)) )).

% Cyc Assertion #1643597:
fof(ax3_4424,axiom,(
    genlmt(c_coaforceratio1defaultassumptionmt,c_basekb) )).

% Cyc Assertion #995314:
fof(ax3_4425,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_trishwilsontypepadcomblog200503why_are_women_dhtml)),c_translation_27),c_basekb) )).

% Cyc Assertion #1118810:
fof(ax3_4426,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygmt)
        & isa(OBJ,f_antiweapontypefn(c_tank_vehicle)) )
     => artifact(OBJ) ) )).

fof(ax3_4427,axiom,
    ( mtvisible(c_militarygmt)
   => genls(f_antiweapontypefn(c_tank_vehicle),c_artifact) )).

fof(ax3_4428,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygmt)
        & antiweapontypefntank_vehicle(OBJ) )
     => artifact(OBJ) ) )).

% Cyc Assertion #741704:
fof(ax3_4429,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_20),c_basekb) )).

% Cyc Assertion #972464:
fof(ax3_4430,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_memberstripodcomindygalfordtriviahtm)),c_translation_29),c_basekb) )).

% Cyc Assertion #2172566:
fof(ax3_4431,axiom,(
    genlmt(c_tptp_member408_mt,c_basekb) )).

% Cyc Assertion #958111:
fof(ax3_4432,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_14),c_machinelearningspindleheadmt) )).

% Cyc Assertion #478456:
fof(ax3_4433,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnndbcompeople524000024452)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #421008:
fof(ax3_4434,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1788532:
fof(ax3_4435,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_historynasagovsp_09_511pdf)),c_translation_31),c_basekb) )).

% Cyc Assertion #1086158:
fof(ax3_4436,axiom,(
    genlmt(c_horusinstallationontologymappingmt,c_basekb) )).

% Cyc Assertion #1060405:
fof(ax3_4437,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordnicolascageoffset0)),c_translation_33),c_basekb) )).

% Cyc Assertion #1491816:
fof(ax3_4438,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordcheroffset0)),c_translation_31),c_basekb) )).

% Cyc Assertion #1201288:
fof(ax3_4439,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_3),c_basekb) )).

% Cyc Assertion #1431103:
fof(ax3_4440,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertoffset0)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #587750:
fof(ax3_4441,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetfire_combustionprocessexplosion(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #802011:
fof(ax3_4442,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www7scombestdvd2nfdripfdb3h6html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1312073:
fof(ax3_4443,axiom,(
    genlmt(c_testsaresuccessfulmt,c_basekb) )).

% Cyc Assertion #2260633:
fof(ax3_4444,axiom,(
    individual(c_tptptptpcol_16_108765) )).

% Cyc Assertion #1323700:
fof(ax3_4445,axiom,(
    genls(c_softwaretestortype,c_aspatialthing) )).

fof(ax3_4446,axiom,(
    ! [OBJ] :
      ( softwaretestortype(OBJ)
     => aspatialthing(OBJ) ) )).

% Cyc Assertion #685580:
fof(ax3_4447,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombacommercialdistrict,c_actiononobject,s_33f1ee63_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_4448,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombacommercialdistrict,c_actiononobject,s_33f1ee63_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_4449,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarybombacommercialdistrictactiononobject33f1ee63_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1203223:
fof(ax3_4450,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwiconsoffrightcomjt_12_05htm)),c_translation_14),c_basekb) )).

% Cyc Assertion #2177098:
fof(ax3_4451,axiom,(
    genlmt(c_tptp_member1541_mt,c_basekb) )).

% Cyc Assertion #1286644:
fof(ax3_4452,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_freesheet))
     => partiallytangible(OBJ) ) )).

fof(ax3_4453,axiom,(
    genls(f_groupfn(c_freesheet),c_partiallytangible) )).

fof(ax3_4454,axiom,(
    ! [OBJ] :
      ( groupfnfreesheet(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2053154:
fof(ax3_4455,axiom,(
    genls(c_tptpcol_7_92163,c_tptpcol_6_92162) )).

fof(ax3_4456,axiom,(
    ! [OBJ] :
      ( tptpcol_7_92163(OBJ)
     => tptpcol_6_92162(OBJ) ) )).

% Cyc Assertion #955665:
fof(ax3_4457,axiom,(
    applicationcontext(c_ehbthighlightsintermediatevocabmt) )).

% Cyc Assertion #479625:
fof(ax3_4458,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgiabgovtnzdefaultaspchannelmemberspagemembers)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1475572:
fof(ax3_4459,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwvwebsitescomweatherfl_weatherphp)),c_translation_2),c_basekb) )).

% Cyc Assertion #1647685:
fof(ax3_4460,axiom,(
    genls(c_collapsible,c_partiallytangible) )).

fof(ax3_4461,axiom,(
    ! [OBJ] :
      ( collapsible(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1342638:
fof(ax3_4462,axiom,(
    genlmt(c_rkfobservationanalysisproceduremt,c_basekb) )).

% Cyc Assertion #1786205:
fof(ax3_4463,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvdfevercouknewsnews0805shtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173614:
fof(ax3_4464,axiom,(
    genlmt(c_tptp_member670_mt,c_basekb) )).

% Cyc Assertion #1468831:
fof(ax3_4465,axiom,(
    genls(c_combatoutpost,c_partiallytangible) )).

fof(ax3_4466,axiom,(
    ! [OBJ] :
      ( combatoutpost(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #747983:
fof(ax3_4467,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwharvestfieldscahorrortheshadowshadow132htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #247342:
fof(ax3_4468,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadianwestern_guard_partyftppyorgscanadianwestern_guard_partycanadaright)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1770721:
fof(ax3_4469,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_m1285is_7_33ai_105735842)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #676531:
fof(ax3_4470,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbraintrustdvcomessaysdigital_ragehtml)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2180866:
fof(ax3_4471,axiom,(
    genlmt(c_tptp_member2483_mt,c_basekb) )).

% Cyc Assertion #458061:
fof(ax3_4472,axiom,(
    genlmt(c_tokenizationsmt,c_basekb) )).

% Cyc Assertion #1576450:
fof(ax3_4473,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlrbcoukv26n06edga01_html)),c_translation_2),c_basekb) )).

% Cyc Assertion #665852:
fof(ax3_4474,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnyfolkloreorgprogsfc99explorehtml)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #633427:
fof(ax3_4475,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcrichtonismscom03losingtimeshtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1640940:
fof(ax3_4476,axiom,(
    genls(c_chocolategiftbasket,c_artifact) )).

fof(ax3_4477,axiom,(
    ! [OBJ] :
      ( chocolategiftbasket(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #654228:
fof(ax3_4478,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesettrough_topographicalunderwaterlocation(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #818282:
fof(ax3_4479,axiom,(
    genlmt(c_unitedkingdomsociallifemt,c_gregoriancalendarmt) )).

% Cyc Assertion #472065:
fof(ax3_4480,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtbaptistcomaabpbc209htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #1139347:
fof(ax3_4481,axiom,(
    genls(c_hydrocarbon,c_inanimateobject) )).

fof(ax3_4482,axiom,(
    ! [OBJ] :
      ( hydrocarbon(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #2174778:
fof(ax3_4483,axiom,(
    genlmt(c_tptp_member961_mt,c_basekb) )).

% Cyc Assertion #1737559:
fof(ax3_4484,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive200409)),c_translation_12),c_machinelearningspindleheadmt) )).

% Cyc Assertion #976441:
fof(ax3_4485,axiom,(
    ! [TERM,INDEPCOL,PRED,DEPCOL] :
      ( ( isa(TERM,INDEPCOL)
        & relationexistsall(PRED,DEPCOL,INDEPCOL) )
     => isa(f_relationexistsallfn(TERM,PRED,DEPCOL,INDEPCOL),DEPCOL) ) )).

fof(ax3_4486,axiom,(
    resultisaarg(c_relationexistsallfn,n_3) )).

% Cyc Assertion #1473072:
fof(ax3_4487,axiom,(
    genlmt(c_kidnappingforransomsourcespindleheadmt,c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #1612172:
fof(ax3_4488,axiom,(
    genls(c_getwellflowerarrangement,c_artifact) )).

fof(ax3_4489,axiom,(
    ! [OBJ] :
      ( getwellflowerarrangement(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1303008:
fof(ax3_4490,axiom,(
    genlmt(c_massmediadatamt,c_gregoriancalendarmt) )).

% Cyc Assertion #1130883:
fof(ax3_4491,axiom,(
    genlmt(c_diseaselexicalmt,c_basekb) )).

% Cyc Assertion #331795:
fof(ax3_4492,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadiannorthern_foundationcanadaright)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2179622:
fof(ax3_4493,axiom,(
    genlmt(c_tptp_member2172_mt,c_basekb) )).

% Cyc Assertion #300744:
fof(ax3_4494,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentshowbiz2987670stm)),c_translation_30),c_basekb) )).

% Cyc Assertion #2193422:
fof(ax3_4495,axiom,(
    ! [TERM] :
      ( executionbyfiringsquad(TERM)
     => tptp_9_597(TERM,f_relationallexistsfn(TERM,c_tptp_9_597,c_executionbyfiringsquad,c_tptpcol_14_32429)) ) )).

fof(ax3_4496,axiom,(
    relationallexists(c_tptp_9_597,c_executionbyfiringsquad,c_tptpcol_14_32429) )).

% Cyc Assertion #2176310:
fof(ax3_4497,axiom,(
    genlmt(c_tptp_member1344_mt,c_basekb) )).

% Cyc Assertion #1589839:
fof(ax3_4498,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0375726721vglance)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1088389:
fof(ax3_4499,axiom,(
    hpkb_y2_cm_pq_microtheory(c_pq214mt) )).

% Cyc Assertion #542554:
fof(ax3_4500,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwentropiaforumcomforumshistorytopic2216_1html)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1275099:
fof(ax3_4501,axiom,(
    genls(c_unmannedgroundvehicle_2,c_individual) )).

fof(ax3_4502,axiom,(
    ! [OBJ] :
      ( unmannedgroundvehicle_2(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #299171:
fof(ax3_4503,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbali_travelnetcomhotelspuribukit_kembar)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1211377:
fof(ax3_4504,axiom,(
    genls(c_concavetangibleobject,c_partiallytangible) )).

fof(ax3_4505,axiom,(
    ! [OBJ] :
      ( concavetangibleobject(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1598168:
fof(ax3_4506,axiom,(
    genls(c_place,c_enduringthing_localized) )).

fof(ax3_4507,axiom,(
    ! [OBJ] :
      ( place(OBJ)
     => enduringthing_localized(OBJ) ) )).

% Cyc Assertion #2171710:
fof(ax3_4508,axiom,(
    genlmt(c_tptp_member194_mt,c_basekb) )).

% Cyc Assertion #822206:
fof(ax3_4509,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1629742:
fof(ax3_4510,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0375726721vglance)),c_translation_22),c_machinelearningspindleheadmt) )).

% Cyc Assertion #664369:
fof(ax3_4511,axiom,
    ( mtvisible(c_englishmt)
   => prettystring(c_gesturingbywinking,s_wink) )).

% Cyc Assertion #209361:
fof(ax3_4512,axiom,(
    genlmt(c_relationexamplesmt,c_basekb) )).

% Cyc Assertion #1503298:
fof(ax3_4513,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbraintrustdvcomessaysdigital_ragehtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1028168:
fof(ax3_4514,axiom,(
    transitivebinarypredicate(c_genlkbcontenttests) )).

% Cyc Assertion #1314836:
fof(ax3_4515,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_joyfulmusictripodcompage4html)),c_translation_22),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1079748:
fof(ax3_4516,axiom,(
    genlmt(c_ldscgeneralcollectormt,f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1997)))) )).

% Cyc Assertion #198432:
fof(ax3_4517,axiom,(
    genls(c_conjecturalcontext,c_microtheory) )).

fof(ax3_4518,axiom,(
    ! [OBJ] :
      ( conjecturalcontext(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #927969:
fof(ax3_4519,axiom,(
    genlmt(c_saicbioterrorismeventsdatamt,c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #446694:
fof(ax3_4520,axiom,(
    genlmt(c_saffroninterestingnessrulesmt,c_basekb) )).

% Cyc Assertion #443315:
fof(ax3_4521,axiom,(
    genls(c_acquiringresourcesevent,c_individual) )).

fof(ax3_4522,axiom,(
    ! [OBJ] :
      ( acquiringresourcesevent(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1594243:
fof(ax3_4523,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_19),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2099230:
fof(ax3_4524,axiom,(
    genls(c_tptpcol_5_110593,c_tptpcol_4_106497) )).

fof(ax3_4525,axiom,(
    ! [OBJ] :
      ( tptpcol_5_110593(OBJ)
     => tptpcol_4_106497(OBJ) ) )).

% Cyc Assertion #675429:
fof(ax3_4526,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscoopconzstoriespa0205s00575htm)),c_translation_0),c_basekb) )).

% Cyc Assertion #797374:
fof(ax3_4527,axiom,(
    genls(c_investmentgoods,c_individual) )).

fof(ax3_4528,axiom,(
    ! [OBJ] :
      ( investmentgoods(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #452888:
fof(ax3_4529,axiom,(
    genlmt(c_pq204mt,c_basekb) )).

% Cyc Assertion #146121:
fof(ax3_4530,axiom,(
    genls(c_classified,c_individual) )).

fof(ax3_4531,axiom,(
    ! [OBJ] :
      ( classified(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #688854:
fof(ax3_4532,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleadingauthoritiescomtalentaallen_debbieallen_debbiedoc)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1492283:
fof(ax3_4533,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_reachadvantage,c_individual,s_34074b22_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_4534,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_reachadvantage,c_individual,s_34074b22_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_4535,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryreachadvantageindividual34074b22_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1541149:
fof(ax3_4536,axiom,(
    genlmt(c_nonamericanenglishmt,c_basekb) )).

% Cyc Assertion #288285:
fof(ax3_4537,axiom,(
    genlmt(c_iasetscenariomt,c_basekb) )).

% Cyc Assertion #983382:
fof(ax3_4538,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinterstudyorgirelandqueensuniversityintroqueenshtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #1111596:
fof(ax3_4539,axiom,(
    genls(c_normalseveritybugzillabugreport,c_individual) )).

fof(ax3_4540,axiom,(
    ! [OBJ] :
      ( normalseveritybugzillabugreport(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #223565:
fof(ax3_4541,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomfilemelayurencanaenglishteller_of_taleshtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #138327:
fof(ax3_4542,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwallmovieportalcomm1997_shine62html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1478040:
fof(ax3_4543,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhealthboardscomboardsshowthreadphpgotolastpostt128185)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2171862:
fof(ax3_4544,axiom,(
    genlmt(c_tptp_member232_mt,c_basekb) )).

% Cyc Assertion #1088965:
fof(ax3_4545,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk2hientertainment4085469stm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1145321:
fof(ax3_4546,axiom,(
    arg2isa(c_typically,c_setorcollection) )).

fof(ax3_4547,axiom,(
    ! [ARG1,ARG2] :
      ( typically(ARG1,ARG2)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #929041:
fof(ax3_4548,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_timeline__syria),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1601809:
fof(ax3_4549,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrnscompages4action96html)),c_translation_31),c_basekb) )).

% Cyc Assertion #1650161:
fof(ax3_4550,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_31),c_basekb) )).

% Cyc Assertion #2184850:
fof(ax3_4551,axiom,(
    genlmt(c_tptp_member3479_mt,c_basekb) )).

% Cyc Assertion #2174846:
fof(ax3_4552,axiom,(
    genlmt(c_tptp_member978_mt,c_basekb) )).

% Cyc Assertion #846435:
fof(ax3_4553,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_criticsocietycomreviewaspid1554)),c_translation_31),c_basekb) )).

% Cyc Assertion #2357898:
fof(ax3_4554,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member450_mt)
        & isa(INS,f_liquidfn(c_methylisocyanate)) )
     => tptpofobject(INS,f_tptpquantityfn_3(n_517)) ) )).

fof(ax3_4555,axiom,
    ( mtvisible(c_tptp_member450_mt)
   => relationallinstance(c_tptpofobject,f_liquidfn(c_methylisocyanate),f_tptpquantityfn_3(n_517)) )).

% Cyc Assertion #1131394:
fof(ax3_4556,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtnttvtitle0324281_115100html)),c_translation_27),c_basekb) )).

% Cyc Assertion #436175:
fof(ax3_4557,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_exceptionalperformertypeofcharacteristicactivityfn(f_playerofinstrumentfn(c_cello)))
     => partiallytangible(OBJ) ) )).

fof(ax3_4558,axiom,(
    genls(f_exceptionalperformertypeofcharacteristicactivityfn(f_playerofinstrumentfn(c_cello)),c_partiallytangible) )).

fof(ax3_4559,axiom,(
    ! [OBJ] :
      ( exceptionalperformertypeofcharacteristicactivityfnplayerofinstrumentfncello(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #261444:
fof(ax3_4560,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1785672:
fof(ax3_4561,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwajrorgarticle_printableaspid750)),c_translation_0),c_basekb) )).

% Cyc Assertion #729473:
fof(ax3_4562,axiom,(
    genls(c_topographicalfeature,c_geographicalregion) )).

fof(ax3_4563,axiom,(
    ! [OBJ] :
      ( topographicalfeature(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #576233:
fof(ax3_4564,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjudygarlandoffset0)),c_translation_29),c_basekb) )).

% Cyc Assertion #1305806:
fof(ax3_4565,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwproductofneglectcomfunfactshtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #582816:
fof(ax3_4566,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_medeasmedialistsblueblogchcinema)),c_translation_32),c_basekb) )).

% Cyc Assertion #1796227:
fof(ax3_4567,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_blogouter_courtcomegobrowsersean_conneryhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1137853:
fof(ax3_4568,axiom,(
    genlmt(c_socreport_cia_20030427_reportcontent,c_basekb) )).

% Cyc Assertion #1562798:
fof(ax3_4569,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_the_cruciblebiographyms)),c_translation_22),c_machinelearningspindleheadmt) )).

% Cyc Assertion #405124:
fof(ax3_4570,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjfk_onlinecomjfk100bigjimhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173206:
fof(ax3_4571,axiom,(
    genlmt(c_tptp_member568_mt,c_basekb) )).

% Cyc Assertion #613028:
fof(ax3_4572,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbbccoukcoventrycontentarticles20041118theatre_review_silas_marner_at_talisman_featureshtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #835440:
fof(ax3_4573,axiom,(
    genlmt(c_humansociallife_expectationreasoningmt,c_humansociallifemt) )).

% Cyc Assertion #425098:
fof(ax3_4574,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamericanveterannewspaperorgavn_nreleasehtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1410911:
fof(ax3_4575,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordchristinetayloroffset0)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2178514:
fof(ax3_4576,axiom,(
    genlmt(c_tptp_member1895_mt,c_basekb) )).

% Cyc Assertion #844849:
fof(ax3_4577,axiom,(
    genls(c_collectible,c_partiallytangible) )).

fof(ax3_4578,axiom,(
    ! [OBJ] :
      ( collectible(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2185934:
fof(ax3_4579,axiom,(
    genlmt(c_tptp_member3750_mt,c_basekb) )).

% Cyc Assertion #697383:
fof(ax3_4580,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwclubmomcomjforumpostslist75142052page)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #847425:
fof(ax3_4581,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_trishwilsontypepadcomblog200503why_are_women_dhtml)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184180:
fof(ax3_4582,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member3311_mt) )).

% Cyc Assertion #2173050:
fof(ax3_4583,axiom,(
    genlmt(c_tptp_member529_mt,c_basekb) )).

% Cyc Assertion #403687:
fof(ax3_4584,axiom,(
    genlmt(c_uiainternalscriptshandlingmt,c_basekb) )).

% Cyc Assertion #1398075:
fof(ax3_4585,axiom,(
    genlmt(f_contentmtfn(c_testsuborganizations_fht),c_basekb) )).

% Cyc Assertion #558098:
fof(ax3_4586,axiom,(
    genls(c_formaldehyde,c_partiallytangible) )).

fof(ax3_4587,axiom,(
    ! [OBJ] :
      ( formaldehyde(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2248891:
fof(ax3_4588,axiom,
    ( mtvisible(c_tptp_member974_mt)
   => passageoflines_rearward(c_tptppassageoflines_rearward) )).

% Cyc Assertion #2002210:
fof(ax3_4589,axiom,(
    firstordercollection(c_tptpcol_16_71788) )).

% Cyc Assertion #345914:
fof(ax3_4590,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtalkingbookworldcomfeaturedbook1aspstoreurltalkingbookworldbookid193105620x)),c_translation_33),c_basekb) )).

% Cyc Assertion #2463166:
fof(ax3_4591,axiom,(
    genlmt(c_tptpgeo_member8_mt,c_tptpgeo_spindleheadmt) )).

% Cyc Assertion #2378183:
fof(ax3_4592,axiom,(
    individual(c_tptpncollectionsubsetfncomputermemorythesetofmem_3thereexistsnum_3andgreaterthannum_3256isamem_3computermemoryisanum_3integersizeparameterofobjectmem_3megabytenum_3) )).

% Cyc Assertion #377598:
fof(ax3_4593,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgreenleftorgauback2004588588p18bhtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #739650:
fof(ax3_4594,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_8),c_basekb) )).

% Cyc Assertion #2183886:
fof(ax3_4595,axiom,(
    genlmt(c_tptp_member3238_mt,c_basekb) )).

% Cyc Assertion #2172090:
fof(ax3_4596,axiom,(
    genlmt(c_tptp_member289_mt,c_basekb) )).

% Cyc Assertion #1059743:
fof(ax3_4597,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_allpeoplearehumanmt) )).

% Cyc Assertion #2363011:
fof(ax3_4598,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_spindleheadmt)
        & supplies(INS) )
     => tptpofobject(INS,f_tptpquantityfn_14(n_232)) ) )).

fof(ax3_4599,axiom,
    ( mtvisible(c_tptp_spindleheadmt)
   => relationallinstance(c_tptpofobject,c_supplies,f_tptpquantityfn_14(n_232)) )).

% Cyc Assertion #1440452:
fof(ax3_4600,axiom,(
    genls(c_weaponizingsomething,c_individual) )).

fof(ax3_4601,axiom,(
    ! [OBJ] :
      ( weaponizingsomething(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #409912:
fof(ax3_4602,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_parametertypeofprogramfn(c_cycnounphrasechunker))
     => individual(OBJ) ) )).

fof(ax3_4603,axiom,(
    genls(f_parametertypeofprogramfn(c_cycnounphrasechunker),c_individual) )).

fof(ax3_4604,axiom,(
    ! [OBJ] :
      ( parametertypeofprogramfncycnounphrasechunker(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #234107:
fof(ax3_4605,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdiacriticacomsobaka2004arafathtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2174542:
fof(ax3_4606,axiom,(
    genlmt(c_tptp_member902_mt,c_basekb) )).

% Cyc Assertion #2180486:
fof(ax3_4607,axiom,(
    genlmt(c_tptp_member2388_mt,c_basekb) )).

% Cyc Assertion #2489448:
fof(ax3_4608,axiom,
    ( mtvisible(c_worldgeographymt)
   => geographicalregion(c_geolocation_x61_y6) )).

% Cyc Assertion #1660544:
fof(ax3_4609,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinformationblastcomtumhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #842490:
fof(ax3_4610,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsteamboatcomwinter_intaspxcategoryid254)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #670352:
fof(ax3_4611,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinq7netent2003jun15ent_5_1htm)),c_translation_0),c_basekb) )).

% Cyc Assertion #1458022:
fof(ax3_4612,axiom,(
    genls(c_zoominginonsomething,c_individual) )).

fof(ax3_4613,axiom,(
    ! [OBJ] :
      ( zoominginonsomething(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1366331:
fof(ax3_4614,axiom,(
    ! [OBJ] :
      ( subcollectiondisjointwithfngeographicalregionthesetneighborhoodcity(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1051431:
fof(ax3_4615,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_functionalroleanalysismt) )).

% Cyc Assertion #1644374:
fof(ax3_4616,axiom,(
    genlmt(c_cookingworldtestcaseentitiesmt,c_currentworlddatacollectormt_nonhomocentric) )).

% Cyc Assertion #1771765:
fof(ax3_4617,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2171250:
fof(ax3_4618,axiom,(
    genlmt(c_tptp_member79_mt,c_basekb) )).

% Cyc Assertion #2191212:
fof(ax3_4619,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_cyclistsmt)
        & executionbyfiringsquad(TERM) )
     => tptp_9_720(TERM,f_relationallexistsfn(TERM,c_tptp_9_720,c_executionbyfiringsquad,c_tptpcol_13_30984)) ) )).

fof(ax3_4620,axiom,
    ( mtvisible(c_cyclistsmt)
   => relationallexists(c_tptp_9_720,c_executionbyfiringsquad,c_tptpcol_13_30984) )).

% Cyc Assertion #1634480:
fof(ax3_4621,axiom,(
    genls(c_memorabilia,c_artifact) )).

fof(ax3_4622,axiom,(
    ! [OBJ] :
      ( memorabilia(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #2305216:
fof(ax3_4623,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => tptpcol_16_44306(c_tptptptpcol_16_44306) )).

% Cyc Assertion #1238267:
fof(ax3_4624,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(f_urlfn(s_http_wwwnctimescomarticles20041030newstop_stories23_29_5810_29_04prt)))) )).

% Cyc Assertion #1022229:
fof(ax3_4625,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_29),c_basekb) )).

% Cyc Assertion #503012:
fof(ax3_4626,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwindependent_bangladeshcomnewsjul0101072005mghtm)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1569738:
fof(ax3_4627,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_2),c_basekb) )).

% Cyc Assertion #271968:
fof(ax3_4628,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpowellscomsubsectionaudiobooksbiographies4html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #486580:
fof(ax3_4629,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwentropiaforumcomforumshistorytopic2216_1html)),c_translation_1),c_basekb) )).

% Cyc Assertion #247117:
fof(ax3_4630,axiom,(
    genlmt(c_fm100_40_fieldmanual_appendixa,c_basekb) )).

% Cyc Assertion #1114858:
fof(ax3_4631,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygmt)
        & isa(OBJ,f_antiweapontypefn(c_chemicalweapon)) )
     => artifact(OBJ) ) )).

fof(ax3_4632,axiom,
    ( mtvisible(c_militarygmt)
   => genls(f_antiweapontypefn(c_chemicalweapon),c_artifact) )).

fof(ax3_4633,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygmt)
        & antiweapontypefnchemicalweapon(OBJ) )
     => artifact(OBJ) ) )).

% Cyc Assertion #339135:
fof(ax3_4634,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_southernappealblogspotcom2004_12_05_southernappeal_archivehtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #963437:
fof(ax3_4635,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiplacesftppyplacescanadacanadaright)),c_translation_1),c_basekb) )).

% Cyc Assertion #1161455:
fof(ax3_4636,axiom,(
    genlmt(c_pathmodeldeonticreasoningmt,c_basekb) )).

% Cyc Assertion #2083028:
fof(ax3_4637,axiom,(
    firstordercollection(c_tptpcol_16_104116) )).

% Cyc Assertion #1479524:
fof(ax3_4638,axiom,(
    genlmt(c_ir_prototype_psc,c_basekb) )).

% Cyc Assertion #485957:
fof(ax3_4639,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(f_urlfn(s_http_yalenewhavenhealthorglibraryhealthguideen_usdrugguidetopicasphwidd00103a1)))) )).

% Cyc Assertion #271802:
fof(ax3_4640,axiom,(
    genls(c_pfizerpanicobsessivecompulsivemarket,c_individual) )).

fof(ax3_4641,axiom,(
    ! [OBJ] :
      ( pfizerpanicobsessivecompulsivemarket(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #590244:
fof(ax3_4642,axiom,(
    genls(c_sweettaste,c_partiallytangible) )).

fof(ax3_4643,axiom,(
    ! [OBJ] :
      ( sweettaste(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1658385:
fof(ax3_4644,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive200409)),c_translation_9),c_basekb) )).

% Cyc Assertion #993731:
fof(ax3_4645,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwclubmomcomjforumpostslist195142052page)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #266633:
fof(ax3_4646,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_bibletoolsorgindexcfmfuseactiondefshowrtdisbeid5435)),c_translation_32),c_basekb) )).

% Cyc Assertion #1014229:
fof(ax3_4647,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_mihtm)),c_translation_1),c_basekb) )).

% Cyc Assertion #179153:
fof(ax3_4648,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpressconnectscomspecialbinghamtonstoriesstory7133shtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #919637:
fof(ax3_4649,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfactmonstercomipkaa0761438html)),c_translation_12),c_machinelearningspindleheadmt) )).

% Cyc Assertion #373679:
fof(ax3_4650,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dailyblabberivillagecomentertainmentarchives200511desperate_house_1html)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #780344:
fof(ax3_4651,axiom,(
    genlmt(c_pq212mt,c_basekb) )).

% Cyc Assertion #2178782:
fof(ax3_4652,axiom,(
    genlmt(c_tptp_member1962_mt,c_basekb) )).

% Cyc Assertion #2174710:
fof(ax3_4653,axiom,(
    genlmt(c_tptp_member944_mt,c_basekb) )).

% Cyc Assertion #1633418:
fof(ax3_4654,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_shotdown,c_actiononobject,s_340e28f5_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_4655,axiom,(
    genls(f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_shotdown,c_actiononobject,s_340e28f5_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_4656,axiom,(
    ! [OBJ] :
      ( unsatisfactoryattempttofnpropersubcollectionnamedfn_ternaryshotdownactiononobject340e28f5_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1538135:
fof(ax3_4657,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_artobject))
     => partiallytangible(OBJ) ) )).

fof(ax3_4658,axiom,(
    genls(f_groupfn(c_artobject),c_partiallytangible) )).

fof(ax3_4659,axiom,(
    ! [OBJ] :
      ( groupfnartobject(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #954942:
fof(ax3_4660,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_b00004w20fvglanceviquotes_trivia)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #564555:
fof(ax3_4661,axiom,(
    genlmt(c_uia_halochemistry_demoenvironmentmt,c_basekb) )).

% Cyc Assertion #147086:
fof(ax3_4662,axiom,(
    genlmt(c_alchemyusgovtorgtestmt,c_basekb) )).

% Cyc Assertion #710262:
fof(ax3_4663,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinq7netent2003jun15ent_5_1htm)),c_translation_1),c_basekb) )).

% Cyc Assertion #585514:
fof(ax3_4664,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_evaluatingvalueofwithrespecttofn(c_securemailguard,c_missionspecificationmicrotheory))
     => individual(OBJ) ) )).

fof(ax3_4665,axiom,(
    genls(f_evaluatingvalueofwithrespecttofn(c_securemailguard,c_missionspecificationmicrotheory),c_individual) )).

fof(ax3_4666,axiom,(
    ! [OBJ] :
      ( evaluatingvalueofwithrespecttofnsecuremailguardmissionspecificationmicrotheory(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1191882:
fof(ax3_4667,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnowtorontocomissues1719entfilmhtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #594971:
fof(ax3_4668,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmedical_librarynetsites_lupus_erythematosishtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1049922:
fof(ax3_4669,axiom,(
    genls(c_aquaintkbpilotevaluationproblemfromparc,c_individual) )).

fof(ax3_4670,axiom,(
    ! [OBJ] :
      ( aquaintkbpilotevaluationproblemfromparc(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2172114:
fof(ax3_4671,axiom,(
    genlmt(c_tptp_member295_mt,c_basekb) )).

% Cyc Assertion #1121188:
fof(ax3_4672,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_1),c_basekb) )).

% Cyc Assertion #1114899:
fof(ax3_4673,axiom,(
    genls(c_coatypebyownerhostility,c_collection) )).

fof(ax3_4674,axiom,(
    ! [OBJ] :
      ( coatypebyownerhostility(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1484472:
fof(ax3_4675,axiom,(
    arg2isa(c_suppliedwithfrom,c_collection) )).

fof(ax3_4676,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( suppliedwithfrom(ARG1,ARG2,ARG3)
     => collection(ARG2) ) )).

% Cyc Assertion #1304390:
fof(ax3_4677,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycombenhecht)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #899762:
fof(ax3_4678,axiom,(
    genlmt(c_humansociallifemt,c_basekb) )).

% Cyc Assertion #1008629:
fof(ax3_4679,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtvcomhome_improvementbackstage_passepisode23169summaryhtml)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1173057:
fof(ax3_4680,axiom,(
    genlmt(c_germanlexicalmt,c_basekb) )).

% Cyc Assertion #788493:
fof(ax3_4681,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaahcelebcompicsdana_brownhtml)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175806:
fof(ax3_4682,axiom,(
    genlmt(c_tptp_member1218_mt,c_basekb) )).

% Cyc Assertion #965689:
fof(ax3_4683,axiom,(
    genls(c_pfizercardiovascularproduct,c_individual) )).

fof(ax3_4684,axiom,(
    ! [OBJ] :
      ( pfizercardiovascularproduct(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1166530:
fof(ax3_4685,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrockiesguidecomguiderocky_mountainsthe_terrain_parks_half_pipes_at_steamboat_springs_coloradohtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #1561966:
fof(ax3_4686,axiom,(
    uniformresourcelocator(f_urlfn(s_http_wwwwmuciacommkmk_album_200207_2aspprintpage1)) )).

% Cyc Assertion #1628796:
fof(ax3_4687,axiom,(
    defaultmonotonicpredicate(c_genls) )).

% Cyc Assertion #912856:
fof(ax3_4688,axiom,(
    genlmt(c_machinelearningspindleheadmt,c_analystdatabasemt) )).

% Cyc Assertion #139777:
fof(ax3_4689,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfargonebookscomviktorprhtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #954907:
fof(ax3_4690,axiom,(
    genlmt(f_contentmtfn(c_fg1_feature_type_hl_id_ks),c_basekb) )).

% Cyc Assertion #484928:
fof(ax3_4691,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_kuwait,c_individual,s_34057665_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_4692,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_kuwait,c_individual,s_34057665_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_4693,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarykuwaitindividual34057665_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1684405:
fof(ax3_4694,axiom,(
    genlmt(f_contextofpcwfn(c_hezbollahinprofile),c_ldscgeneralcollectormt) )).

% Cyc Assertion #848497:
fof(ax3_4695,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleadingauthoritiescomtalentaallen_debbieallen_debbiedoc)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172858:
fof(ax3_4696,axiom,(
    genlmt(c_tptp_member481_mt,c_basekb) )).

% Cyc Assertion #352020:
fof(ax3_4697,axiom,(
    genls(c_smooth,c_partiallytangible) )).

fof(ax3_4698,axiom,(
    ! [OBJ] :
      ( smooth(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1263361:
fof(ax3_4699,axiom,(
    genlmt(c_definitionofnetworkmt,c_basekb) )).

% Cyc Assertion #1614467:
fof(ax3_4700,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthedailybulletincompostcardsmar9chtm)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #448212:
fof(ax3_4701,axiom,(
    genlmt(c_worldoiltransitchokepointsmt,c_hpkbvocabmt) )).

% Cyc Assertion #654717:
fof(ax3_4702,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_englishkbscokrsocietyevents1355570_11777html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #717812:
fof(ax3_4703,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnyfolkloreorgprogsfc99explorehtml)),c_translation_27),c_basekb) )).

% Cyc Assertion #1136278:
fof(ax3_4704,axiom,(
    genls(c_mythicalmonster,c_partiallytangible) )).

fof(ax3_4705,axiom,(
    ! [OBJ] :
      ( mythicalmonster(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #998620:
fof(ax3_4706,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_citysquare,c_partiallytangible,s_3422e972_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_4707,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_citysquare,c_partiallytangible,s_3422e972_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_4708,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarycitysquarepartiallytangible3422e972_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1494101:
fof(ax3_4709,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweonlinecomnewsitems011248700html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2187366:
fof(ax3_4710,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_tptp_member2589_mt)
        & isa(TERM,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )
     => tptp_6_9(TERM,f_relationallexistsfn(TERM,c_tptp_6_9,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_29724)) ) )).

fof(ax3_4711,axiom,
    ( mtvisible(c_tptp_member2589_mt)
   => relationallexists(c_tptp_6_9,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_29724) )).

% Cyc Assertion #2177646:
fof(ax3_4712,axiom,(
    genlmt(c_tptp_member1678_mt,c_basekb) )).

% Cyc Assertion #251084:
fof(ax3_4713,axiom,(
    genlpreds(c_subsetof,c_is_underspecified) )).

fof(ax3_4714,axiom,(
    ! [ARG1,ARG2] :
      ( subsetof(ARG1,ARG2)
     => is_underspecified(ARG1,ARG2) ) )).

% Cyc Assertion #1066715:
fof(ax3_4715,axiom,(
    transitivebinarypredicate(c_potentialcompetitorlhms) )).

% Cyc Assertion #1389481:
fof(ax3_4716,axiom,(
    individual(f_latepartfn(f_monthfn(c_february,f_yearfn(n_2005)))) )).

% Cyc Assertion #1457152:
fof(ax3_4717,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_erdosmathunbcajdpscifihtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1735918:
fof(ax3_4718,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_15),c_machinelearningspindleheadmt) )).

% Cyc Assertion #301929:
fof(ax3_4719,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2153255:
fof(ax3_4720,axiom,(
    genlpreds(c_tptptypes_6_403,c_tptptypes_5_387) )).

fof(ax3_4721,axiom,(
    ! [ARG1,ARG2] :
      ( tptptypes_6_403(ARG1,ARG2)
     => tptptypes_5_387(ARG1,ARG2) ) )).

% Cyc Assertion #2186806:
fof(ax3_4722,axiom,(
    genlmt(c_tptp_member3968_mt,c_basekb) )).

% Cyc Assertion #806672:
fof(ax3_4723,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_qa3817is_199812ai_n8810013)),c_translation_33),c_basekb) )).

% Cyc Assertion #1594444:
fof(ax3_4724,axiom,(
    genlmt(c_cblbefriendlynodeexecutionmt,c_basekb) )).

% Cyc Assertion #2174086:
fof(ax3_4725,axiom,(
    genlmt(c_tptp_member788_mt,c_basekb) )).

% Cyc Assertion #167406:
fof(ax3_4726,axiom,(
    genls(c_diisopropylmethylphosphonate,c_partiallytangible) )).

fof(ax3_4727,axiom,(
    ! [OBJ] :
      ( diisopropylmethylphosphonate(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #335406:
fof(ax3_4728,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1028120:
fof(ax3_4729,axiom,(
    genlmt(c_miptdatabase19681997_termsmt,c_ldscgeneralcollectormt) )).

% Cyc Assertion #2173806:
fof(ax3_4730,axiom,(
    genlmt(c_tptp_member718_mt,c_basekb) )).

% Cyc Assertion #1752969:
fof(ax3_4731,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsaramacomforumsshowthreadphpthreadid35479)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #554109:
fof(ax3_4732,axiom,
    ( mtvisible(c_ciaworldfactbook1995mt)
   => genls(c_salt_chemicalsubstance,c_partiallytangible) )).

fof(ax3_4733,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_ciaworldfactbook1995mt)
        & salt_chemicalsubstance(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2186102:
fof(ax3_4734,axiom,(
    genlmt(c_tptp_member3792_mt,c_basekb) )).

% Cyc Assertion #1530107:
fof(ax3_4735,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_plain_topographical))
     => partiallytangible(OBJ) ) )).

fof(ax3_4736,axiom,(
    genls(f_groupfn(c_plain_topographical),c_partiallytangible) )).

fof(ax3_4737,axiom,(
    ! [OBJ] :
      ( groupfnplain_topographical(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1564997:
fof(ax3_4738,axiom,(
    genlmt(c_libraryofcongresscountrystudiesmt,c_basekb) )).

% Cyc Assertion #1425205:
fof(ax3_4739,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_dangerousthing,c_objectfoundinlocation,c_underwaterlocation))
     => spatialthing_nonsituational(OBJ) ) )).

fof(ax3_4740,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_dangerousthing,c_objectfoundinlocation,c_underwaterlocation),c_spatialthing_nonsituational) )).

fof(ax3_4741,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefndangerousthingobjectfoundinlocationunderwaterlocation(OBJ)
     => spatialthing_nonsituational(OBJ) ) )).

% Cyc Assertion #1005505:
fof(ax3_4742,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrhdservicescomrhd20serviceshtm)),c_translation_6),c_basekb) )).

% Cyc Assertion #1448873:
fof(ax3_4743,axiom,(
    genls(c_antsq_138_sensor,c_partiallytangible) )).

fof(ax3_4744,axiom,(
    ! [OBJ] :
      ( antsq_138_sensor(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #672445:
fof(ax3_4745,axiom,(
    genlmt(c_textualentailmentgenericbackgroundmt,c_basekb) )).

% Cyc Assertion #693905:
fof(ax3_4746,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_subatomicparticle))
     => partiallytangible(OBJ) ) )).

fof(ax3_4747,axiom,(
    genls(f_groupfn(c_subatomicparticle),c_partiallytangible) )).

fof(ax3_4748,axiom,(
    ! [OBJ] :
      ( groupfnsubatomicparticle(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1063125:
fof(ax3_4749,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_30),c_basekb) )).

% Cyc Assertion #710528:
fof(ax3_4750,axiom,(
    genlmt(c_butler_fastholder_querymt,c_basekb) )).

% Cyc Assertion #2177794:
fof(ax3_4751,axiom,(
    genlmt(c_tptp_member1715_mt,c_basekb) )).

% Cyc Assertion #2177334:
fof(ax3_4752,axiom,(
    genlmt(c_tptp_member1600_mt,c_basekb) )).

% Cyc Assertion #310411:
fof(ax3_4753,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_acetylcholinesterase,c_partiallytangible) )).

fof(ax3_4754,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & acetylcholinesterase(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #660146:
fof(ax3_4755,axiom,(
    genlmt(c_cycorpproductsmt,c_worldhistorymt) )).

% Cyc Assertion #789651:
fof(ax3_4756,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwridleycamacukbsbbsb15html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1802900:
fof(ax3_4757,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetsurfaceregion_finiteconicalsurface_withoutbase(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #387837:
fof(ax3_4758,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_listsibiblioorgpipermailcorpus_paul20030323004209html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #354923:
fof(ax3_4759,axiom,(
    ! [OBJ] :
      ( collectionsubsetfnterroristattackthesetofeventandisaeventterroristattackeventoccursateventisrael(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1285600:
fof(ax3_4760,axiom,(
    genlmt(f_lexicalmtforlanguagefn(c_japaneselanguage),c_basekb) )).

% Cyc Assertion #2171730:
fof(ax3_4761,axiom,(
    genlmt(c_tptp_member199_mt,c_basekb) )).

% Cyc Assertion #858668:
fof(ax3_4762,axiom,(
    genls(c_refiningaconceptinuia,c_individual) )).

fof(ax3_4763,axiom,(
    ! [OBJ] :
      ( refiningaconceptinuia(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2176892:
fof(ax3_4764,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member1489_mt) )).

% Cyc Assertion #724041:
fof(ax3_4765,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetmound_ngaunderwaterlocation(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2491128:
fof(ax3_4766,axiom,
    ( mtvisible(c_tptpgeo_member2_mt)
   => geographicalsubregions(c_georegion_l1_x2_y0,c_georegion_l2_x6_y2) )).

% Cyc Assertion #1056951:
fof(ax3_4767,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wildcatarizonaedupapers911407_1_mhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1702235:
fof(ax3_4768,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_stufffn(c_mushroom))
     => partiallytangible(OBJ) ) )).

fof(ax3_4769,axiom,(
    genls(f_stufffn(c_mushroom),c_partiallytangible) )).

fof(ax3_4770,axiom,(
    ! [OBJ] :
      ( stufffnmushroom(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #622433:
fof(ax3_4771,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwswordandsorceryorgwormouroborosasp)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #898939:
fof(ax3_4772,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwzipplecomnewsandpoliticsisraelnews20010104_more_talksshtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #199072:
fof(ax3_4773,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwangelfirecomtv2ofawgiles09html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #534603:
fof(ax3_4774,axiom,(
    genls(c_waterworks,c_partiallytangible) )).

fof(ax3_4775,axiom,(
    ! [OBJ] :
      ( waterworks(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #423985:
fof(ax3_4776,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_timblairspleenvillecomarchives007948php)),c_translation_3),c_basekb) )).

% Cyc Assertion #2359120:
fof(ax3_4777,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3441_mt)
        & whitehairedhuman(INS) )
     => tptpofobject(INS,f_tptpquantityfn_9(n_606)) ) )).

fof(ax3_4778,axiom,
    ( mtvisible(c_tptp_member3441_mt)
   => relationallinstance(c_tptpofobject,c_whitehairedhuman,f_tptpquantityfn_9(n_606)) )).

% Cyc Assertion #2181235:
fof(ax3_4779,axiom,(
    genlmt(c_tptp_member2575_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #161602:
fof(ax3_4780,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaquariusrecordsorgcatd10html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #868779:
fof(ax3_4781,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_lifsostypepadcomlulled_into_a_false_sense200509another_one_makhtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1649318:
fof(ax3_4782,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnowtorontocomissues2004_10_07music_discs2_phtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #863141:
fof(ax3_4783,axiom,(
    genlmt(c_non_opecfactsheetmt,c_hpkbvocabmt) )).

% Cyc Assertion #157903:
fof(ax3_4784,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpvponlinecomnewsproarchivesarc7_2003html)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2181070:
fof(ax3_4785,axiom,(
    genlmt(c_tptp_member2534_mt,c_basekb) )).

% Cyc Assertion #1004893:
fof(ax3_4786,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_manager,c_controls,c_estate_legalentity))
     => partiallytangible(OBJ) ) )).

fof(ax3_4787,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_manager,c_controls,c_estate_legalentity),c_partiallytangible) )).

fof(ax3_4788,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnmanagercontrolsestate_legalentity(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2171146:
fof(ax3_4789,axiom,(
    genlmt(c_tptp_member53_mt,c_basekb) )).

% Cyc Assertion #2183206:
fof(ax3_4790,axiom,(
    genlmt(c_tptp_member3068_mt,c_basekb) )).

% Cyc Assertion #1362010:
fof(ax3_4791,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwomenpriestsorgscripturmollenk4asp)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #831205:
fof(ax3_4792,axiom,(
    genls(c_warhead_w_70,c_individual) )).

fof(ax3_4793,axiom,(
    ! [OBJ] :
      ( warhead_w_70(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2181074:
fof(ax3_4794,axiom,(
    genlmt(c_tptp_member2535_mt,c_basekb) )).

% Cyc Assertion #1266036:
fof(ax3_4795,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesethomosapiensgroupfnhomosapiens(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1542749:
fof(ax3_4796,axiom,
    ( mtvisible(c_massmediadatamt)
   => newspaperissue(f_editionfn(c_usatoday_thenewspaper,f_dayfn(n_9,f_monthfn(c_may,f_yearfn(n_2005))))) )).

% Cyc Assertion #468903:
fof(ax3_4797,axiom,(
    genls(c_partiallytangible,c_threedimensionalthing) )).

fof(ax3_4798,axiom,(
    ! [OBJ] :
      ( partiallytangible(OBJ)
     => threedimensionalthing(OBJ) ) )).

% Cyc Assertion #2174296:
fof(ax3_4799,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member840_mt) )).

% Cyc Assertion #2178602:
fof(ax3_4800,axiom,(
    genlmt(c_tptp_member1917_mt,c_basekb) )).

% Cyc Assertion #2181866:
fof(ax3_4801,axiom,(
    genlmt(c_tptp_member2733_mt,c_basekb) )).

% Cyc Assertion #1258434:
fof(ax3_4802,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_sweden))
     => individual(OBJ) ) )).

fof(ax3_4803,axiom,(
    genls(f_residentfn(c_sweden),c_individual) )).

fof(ax3_4804,axiom,(
    ! [OBJ] :
      ( residentfnsweden(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #951742:
fof(ax3_4805,axiom,(
    genls(c_impurecompound,c_inanimateobject) )).

fof(ax3_4806,axiom,(
    ! [OBJ] :
      ( impurecompound(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #932583:
fof(ax3_4807,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwartsjournalcommediaredir20041212_53783html)),c_translation_2),c_basekb) )).

% Cyc Assertion #2182638:
fof(ax3_4808,axiom,(
    genlmt(c_tptp_member2926_mt,c_basekb) )).

% Cyc Assertion #832768:
fof(ax3_4809,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthestudentroomcoukshowthreadphpt111657page7)),c_translation_2),c_basekb) )).

% Cyc Assertion #1444572:
fof(ax3_4810,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweufsorgukfilmsthe_man_who_would_be_kinghtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2180450:
fof(ax3_4811,axiom,(
    genlmt(c_tptp_member2379_mt,c_basekb) )).

% Cyc Assertion #2185750:
fof(ax3_4812,axiom,(
    genlmt(c_tptp_member3704_mt,c_basekb) )).

% Cyc Assertion #1411140:
fof(ax3_4813,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_khenifra_provincemorocco) )).

% Cyc Assertion #1489179:
fof(ax3_4814,axiom,(
    genlmt(c_accountingmt,c_basekb) )).

% Cyc Assertion #2355717:
fof(ax3_4815,axiom,(
    executionbyfiringsquad(c_tptpexecutionbyfiringsquad_23) )).

% Cyc Assertion #1146222:
fof(ax3_4816,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_threateningtodofn(f_subcollectionofwithrelationfromtypefn(c_killingbyorganism,c_subevents,c_asphyxiation)))
     => individual(OBJ) ) )).

fof(ax3_4817,axiom,(
    genls(f_threateningtodofn(f_subcollectionofwithrelationfromtypefn(c_killingbyorganism,c_subevents,c_asphyxiation)),c_individual) )).

fof(ax3_4818,axiom,(
    ! [OBJ] :
      ( threateningtodofnsubcollectionofwithrelationfromtypefnkillingbyorganismsubeventsasphyxiation(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1634991:
fof(ax3_4819,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwglobalagingorghealthworldciprorivalsdrugshtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #907135:
fof(ax3_4820,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_ethylchlorohydrin,c_partiallytangible) )).

fof(ax3_4821,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & ethylchlorohydrin(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1305990:
fof(ax3_4822,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom2005_08_01_visionsofparadise_archivehtml)),c_translation_31),c_basekb) )).

% Cyc Assertion #1328862:
fof(ax3_4823,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombahighschoolrestroom,c_actiononobject,s_3422c262_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_4824,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombahighschoolrestroom,c_actiononobject,s_3422c262_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_4825,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarybombahighschoolrestroomactiononobject3422c262_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #424147:
fof(ax3_4826,axiom,(
    genls(c_agent_nongeographical,c_enduringthing_localized) )).

fof(ax3_4827,axiom,(
    ! [OBJ] :
      ( agent_nongeographical(OBJ)
     => enduringthing_localized(OBJ) ) )).

% Cyc Assertion #2174930:
fof(ax3_4828,axiom,(
    genlmt(c_tptp_member999_mt,c_basekb) )).

% Cyc Assertion #518580:
fof(ax3_4829,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_netministriesorgbbasicsbbphihtm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184778:
fof(ax3_4830,axiom,(
    genlmt(c_tptp_member3461_mt,c_basekb) )).

% Cyc Assertion #2108187:
fof(ax3_4831,axiom,(
    genls(c_tptpcol_8_114177,c_tptpcol_7_113665) )).

fof(ax3_4832,axiom,(
    ! [OBJ] :
      ( tptpcol_8_114177(OBJ)
     => tptpcol_7_113665(OBJ) ) )).

% Cyc Assertion #198111:
fof(ax3_4833,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthebestlinkscommeasleshtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #274340:
fof(ax3_4834,axiom,(
    genlmt(f_contextofpcwfn(c_truthinlendingact),c_humansociallifemt) )).

% Cyc Assertion #1032896:
fof(ax3_4835,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwchestergovukarchway_interregpartnersvallettahtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1295491:
fof(ax3_4836,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_13),c_basekb) )).

% Cyc Assertion #1435935:
fof(ax3_4837,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrisenetworkorgabouthtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1537201:
fof(ax3_4838,axiom,(
    genlmt(f_optimizedstrategyformfn(f_symmetricdisambiguationstrategyforbinarypredfn(c_conceptuallyrelated)),c_basekb) )).

% Cyc Assertion #1399899:
fof(ax3_4839,axiom,(
    genls(c_encrypted,c_intangibleindividual) )).

fof(ax3_4840,axiom,(
    ! [OBJ] :
      ( encrypted(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #1714918:
fof(ax3_4841,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwconservativeonlineorgnewsletterscts_newsletter_200205htm)),c_translation_33),c_basekb) )).

% Cyc Assertion #1106837:
fof(ax3_4842,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygmt)
        & isa(OBJ,f_antiweapontypefn(c_warplane)) )
     => artifact(OBJ) ) )).

fof(ax3_4843,axiom,
    ( mtvisible(c_militarygmt)
   => genls(f_antiweapontypefn(c_warplane),c_artifact) )).

fof(ax3_4844,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_militarygmt)
        & antiweapontypefnwarplane(OBJ) )
     => artifact(OBJ) ) )).

% Cyc Assertion #806140:
fof(ax3_4845,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcueduirmabout_irmself_study96_theoryhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183052:
fof(ax3_4846,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member3029_mt) )).

% Cyc Assertion #1070153:
fof(ax3_4847,axiom,(
    genlmt(c_californiainvasioncurrentstate1mt,c_basekb) )).

% Cyc Assertion #429666:
fof(ax3_4848,axiom,(
    genlmt(c_specialrelativitymt,c_basekb) )).

% Cyc Assertion #2185094:
fof(ax3_4849,axiom,(
    genlmt(c_tptp_member3540_mt,c_basekb) )).

% Cyc Assertion #679023:
fof(ax3_4850,axiom,(
    genls(c_normal_usual,c_collection) )).

fof(ax3_4851,axiom,(
    ! [OBJ] :
      ( normal_usual(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #954741:
fof(ax3_4852,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #2184046:
fof(ax3_4853,axiom,(
    genlmt(c_tptp_member3278_mt,c_basekb) )).

% Cyc Assertion #818741:
fof(ax3_4854,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfindarticlescomparticlesmi_qa3817is_199812ai_n8810013)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1252259:
fof(ax3_4855,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcarlhiaasencom)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1797433:
fof(ax3_4856,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_saicterroristgroupsdatamt) )).

% Cyc Assertion #506616:
fof(ax3_4857,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_netministriesorgbbasicsbbphihtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #1323595:
fof(ax3_4858,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_greensfarnleyandwortleywardinforeservoir_dog_joins_greenshtm)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1303771:
fof(ax3_4859,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_sitreport_seeking_information_war_on_terrorism),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #2181198:
fof(ax3_4860,axiom,(
    genlmt(c_tptp_member2566_mt,c_basekb) )).

% Cyc Assertion #655643:
fof(ax3_4861,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_timblairspleenvillecomarchives007948php)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172018:
fof(ax3_4862,axiom,(
    genlmt(c_tptp_member271_mt,c_basekb) )).

% Cyc Assertion #1592504:
fof(ax3_4863,axiom,(
    genlmt(f_contentmtfn(c_glassbox_citation_type_ks),c_basekb) )).

% Cyc Assertion #985411:
fof(ax3_4864,axiom,(
    genls(c_inspectionfacility,c_individual) )).

fof(ax3_4865,axiom,(
    ! [OBJ] :
      ( inspectionfacility(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #377226:
fof(ax3_4866,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwweonlinecomnewsitems011107000html)),c_translation_0),c_basekb) )).

% Cyc Assertion #678378:
fof(ax3_4867,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_b0000cbl7avglance)),c_translation_32),c_basekb) )).

% Cyc Assertion #1233765:
fof(ax3_4868,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbellaonlinecomarticlesart38244asp)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175098:
fof(ax3_4869,axiom,(
    genlmt(c_tptp_member1041_mt,c_basekb) )).

% Cyc Assertion #256059:
fof(ax3_4870,axiom,
    ( mtvisible(c_computersoftwaredatamt)
   => architectureindependentcomputerpatchprogram(c_upgradelibsafe_2_0_12_thesoftwarepatch) )).

% Cyc Assertion #1220546:
fof(ax3_4871,axiom,(
    individual(c_berrioilfield) )).

% Cyc Assertion #900796:
fof(ax3_4872,axiom,(
    genlmt(c_machinelearningspindleheadmt,c_saicterrorismeventsdatamt) )).

% Cyc Assertion #2177702:
fof(ax3_4873,axiom,(
    genlmt(c_tptp_member1692_mt,c_basekb) )).

% Cyc Assertion #2179898:
fof(ax3_4874,axiom,(
    genlmt(c_tptp_member2241_mt,c_basekb) )).

% Cyc Assertion #1413866:
fof(ax3_4875,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewageresellercomstoreapf4amazon_products_feedcgioperationitemlookupitemidb00005uo7f)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #215318:
fof(ax3_4876,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mysiteverizonnetsvogl011deadnowhtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #858248:
fof(ax3_4877,axiom,(
    individual(c_belalugosi) )).

% Cyc Assertion #215155:
fof(ax3_4878,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordpriscillapresleyoffset0)),c_translation_33),c_basekb) )).

% Cyc Assertion #869526:
fof(ax3_4879,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesettable_documentpartgraph_documentpartabstractvisualstructure(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2175234:
fof(ax3_4880,axiom,(
    genlmt(c_tptp_member1075_mt,c_basekb) )).

% Cyc Assertion #1313120:
fof(ax3_4881,axiom,
    ( mtvisible(c_modernmilitarytacticsmt)
   => genls(c_coverfromindirectfire_good,c_geographicalregion) )).

fof(ax3_4882,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_modernmilitarytacticsmt)
        & coverfromindirectfire_good(OBJ) )
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #2478616:
fof(ax3_4883,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x8_y28) )).

% Cyc Assertion #365951:
fof(ax3_4884,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwepinionscomcontent_106804514436)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1658412:
fof(ax3_4885,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnytimescombooksfirstssteyn_broadwayhtml)),c_translation_6),c_basekb) )).

% Cyc Assertion #1976404:
fof(ax3_4886,axiom,(
    firstordercollection(c_tptpcol_14_61465) )).

% Cyc Assertion #1244067:
fof(ax3_4887,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_greensfarnleyandwortleywardinforeservoir_dog_joins_greenshtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1697211:
fof(ax3_4888,axiom,
    ( mtvisible(c_englishmt)
   => prettystring(f_instancewithrelationtofn(c_footballteam,c_affiliatedwith,c_beloitcollege),s_thefootballteamwhohasbeenaffiliatedwithbeloitcollege) )).

% Cyc Assertion #2174194:
fof(ax3_4889,axiom,(
    genlmt(c_tptp_member815_mt,c_basekb) )).

% Cyc Assertion #1323369:
fof(ax3_4890,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfyiottawacomcgi_binniveau2cgisfilmsp46055htmla1)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185670:
fof(ax3_4891,axiom,(
    genlmt(c_tptp_member3684_mt,c_basekb) )).

% Cyc Assertion #2175310:
fof(ax3_4892,axiom,(
    genlmt(c_tptp_member1094_mt,c_basekb) )).

% Cyc Assertion #865475:
fof(ax3_4893,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_9),c_basekb) )).

% Cyc Assertion #1125402:
fof(ax3_4894,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_profile__mahmoud_amadinejad),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #1496459:
fof(ax3_4895,axiom,(
    genls(c_artificialwaterfeature,c_partiallytangible) )).

fof(ax3_4896,axiom,(
    ! [OBJ] :
      ( artificialwaterfeature(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1800702:
fof(ax3_4897,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1618402:
fof(ax3_4898,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnytimescombooksfirstssteyn_broadwayhtml)),c_translation_3),c_basekb) )).

% Cyc Assertion #506632:
fof(ax3_4899,axiom,(
    genlmt(c_modernmilitaryweaponsmt,c_basekb) )).

% Cyc Assertion #1326067:
fof(ax3_4900,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_21),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1150183:
fof(ax3_4901,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_threateningtodofn(f_subcollectionofwithrelationfromtypefn(c_killingbyorganism,c_subevents,c_caraccident)))
     => individual(OBJ) ) )).

fof(ax3_4902,axiom,(
    genls(f_threateningtodofn(f_subcollectionofwithrelationfromtypefn(c_killingbyorganism,c_subevents,c_caraccident)),c_individual) )).

fof(ax3_4903,axiom,(
    ! [OBJ] :
      ( threateningtodofnsubcollectionofwithrelationfromtypefnkillingbyorganismsubeventscaraccident(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1420824:
fof(ax3_4904,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #1103167:
fof(ax3_4905,axiom,(
    genls(c_presuppositionvocabterm,c_intangibleindividual) )).

fof(ax3_4906,axiom,(
    ! [OBJ] :
      ( presuppositionvocabterm(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #312741:
fof(ax3_4907,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentshowbiz2987670stm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #898532:
fof(ax3_4908,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvillage_idiotsorgp76)),c_translation_32),c_basekb) )).

% Cyc Assertion #2176526:
fof(ax3_4909,axiom,(
    genlmt(c_tptp_member1398_mt,c_basekb) )).

% Cyc Assertion #1884194:
fof(ax3_4910,axiom,(
    genls(c_tptpcol_4_24578,c_tptpcol_3_16386) )).

fof(ax3_4911,axiom,(
    ! [OBJ] :
      ( tptpcol_4_24578(OBJ)
     => tptpcol_3_16386(OBJ) ) )).

% Cyc Assertion #2176670:
fof(ax3_4912,axiom,(
    genlmt(c_tptp_member1434_mt,c_basekb) )).

% Cyc Assertion #834576:
fof(ax3_4913,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmanythingsorgvoa02020225dr_thtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2181406:
fof(ax3_4914,axiom,(
    genlmt(c_tptp_member2618_mt,c_basekb) )).

% Cyc Assertion #538721:
fof(ax3_4915,axiom,(
    genlmt(c_genericsmt,c_basekb) )).

% Cyc Assertion #146393:
fof(ax3_4916,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #766087:
fof(ax3_4917,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1056527:
fof(ax3_4918,axiom,
    ( mtvisible(c_computersoftwaremt)
   => versionedsoftwareobject(f_softwareversionfn(c_libsafe_theprogram,s_20_10)) )).

% Cyc Assertion #1225382:
fof(ax3_4919,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(s_http_wwwtime4learningcomeducationalpanelhtm))) )).

% Cyc Assertion #2181358:
fof(ax3_4920,axiom,(
    genlmt(c_tptp_member2606_mt,c_basekb) )).

% Cyc Assertion #1166825:
fof(ax3_4921,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmichalegravesnetgravesarticleshtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #1157586:
fof(ax3_4922,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_book_irans_security_policy_in_the_post_revolutionary_era_9),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1601087:
fof(ax3_4923,axiom,(
    arg2isa(c_setorcollectionintersection2fn,c_setorcollection) )).

% Cyc Assertion #1646256:
fof(ax3_4924,axiom,(
    genls(c_weapon_precisionarmament,c_individual) )).

fof(ax3_4925,axiom,(
    ! [OBJ] :
      ( weapon_precisionarmament(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #678340:
fof(ax3_4926,axiom,(
    genls(c_termsuggestortermtype,c_collection) )).

fof(ax3_4927,axiom,(
    ! [OBJ] :
      ( termsuggestortermtype(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #1250958:
fof(ax3_4928,axiom,(
    genlmt(f_contextofpcwfn(c_basichumanrights_undeclaration),c_humansociallifemt) )).

% Cyc Assertion #240119:
fof(ax3_4929,axiom,(
    genlmt(c_womanatconcertimt,c_basekb) )).

% Cyc Assertion #318809:
fof(ax3_4930,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_32),c_basekb) )).

% Cyc Assertion #1225919:
fof(ax3_4931,axiom,(
    genlmt(f_contextofpcwfn(c_waverley),c_basekb) )).

% Cyc Assertion #2178822:
fof(ax3_4932,axiom,(
    genlmt(c_tptp_member1972_mt,c_basekb) )).

% Cyc Assertion #2174210:
fof(ax3_4933,axiom,(
    genlmt(c_tptp_member819_mt,c_basekb) )).

% Cyc Assertion #2175734:
fof(ax3_4934,axiom,(
    genlmt(c_tptp_member1200_mt,c_basekb) )).

% Cyc Assertion #544550:
fof(ax3_4935,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwohiohealthcomhealthreferencereferencebf4f8bfb_a48b_4e58_a52cf44ae9006a1ahtmcategory4691)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1509338:
fof(ax3_4936,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_freepagesgenealogyrootswebcomehowetimeline1820html)),c_translation_29),c_basekb) )).

% Cyc Assertion #1175174:
fof(ax3_4937,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwiconsoffrightcomjt_12_05htm)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1543793:
fof(ax3_4938,axiom,(
    genlmt(c_testvocabularymt,c_mysentientdiscoursetrackingpegcreationtemplatemt) )).

% Cyc Assertion #1731749:
fof(ax3_4939,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinformationblastcomtumhtml)),c_translation_0),c_basekb) )).

% Cyc Assertion #1553014:
fof(ax3_4940,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnndbcompeople243000025168)),c_translation_30),c_basekb) )).

% Cyc Assertion #347224:
fof(ax3_4941,axiom,(
    genls(c_russianmafiaindustrytakeover,c_individual) )).

fof(ax3_4942,axiom,(
    ! [OBJ] :
      ( russianmafiaindustrytakeover(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2186230:
fof(ax3_4943,axiom,(
    genlmt(c_tptp_member3824_mt,c_basekb) )).

% Cyc Assertion #1795875:
fof(ax3_4944,axiom,(
    genlmt(c_three_partiranianplan,c_basekb) )).

% Cyc Assertion #2181766:
fof(ax3_4945,axiom,(
    genlmt(c_tptp_member2708_mt,c_basekb) )).

% Cyc Assertion #352341:
fof(ax3_4946,axiom,(
    genlmt(c_unitedstateshistorymt,c_organizationdatamt) )).

% Cyc Assertion #2185194:
fof(ax3_4947,axiom,(
    genlmt(c_tptp_member3565_mt,c_basekb) )).

% Cyc Assertion #1359696:
fof(ax3_4948,axiom,(
    genls(c_camerashutter,c_artifact) )).

fof(ax3_4949,axiom,(
    ! [OBJ] :
      ( camerashutter(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #822777:
fof(ax3_4950,axiom,(
    genls(c_concealmentlimitingterrain,c_geographicalregion) )).

fof(ax3_4951,axiom,(
    ! [OBJ] :
      ( concealmentlimitingterrain(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #956038:
fof(ax3_4952,axiom,(
    genls(c_attemptingkilling_biologicalsubeventsdefenestration,c_individual) )).

fof(ax3_4953,axiom,(
    ! [OBJ] :
      ( attemptingkilling_biologicalsubeventsdefenestration(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1110417:
fof(ax3_4954,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_27),c_machinelearningspindleheadmt) )).

% Cyc Assertion #286291:
fof(ax3_4955,axiom,(
    disjointwith(c_waitinglist,c_partiallytangible) )).

fof(ax3_4956,axiom,(
    ! [OBJ] :
      ~ ( waitinglist(OBJ)
        & partiallytangible(OBJ) ) )).

% Cyc Assertion #2170982:
fof(ax3_4957,axiom,(
    genlmt(c_tptp_member12_mt,c_basekb) )).

% Cyc Assertion #1669821:
fof(ax3_4958,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmbugcomdb343420)),c_translation_33),c_basekb) )).

% Cyc Assertion #2477375:
fof(ax3_4959,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x6_y2) )).

% Cyc Assertion #1556564:
fof(ax3_4960,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomben20hecht)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182370:
fof(ax3_4961,axiom,(
    genlmt(c_tptp_member2859_mt,c_basekb) )).

% Cyc Assertion #1686916:
fof(ax3_4962,axiom,(
    genlmt(f_lexicalmtforlanguagefn(c_danishlanguage),c_basekb) )).

% Cyc Assertion #893777:
fof(ax3_4963,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enmimihustarsmatt_dillonhtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1420501:
fof(ax3_4964,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomhollywood1195patric1htm)),c_translation_22),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1679511:
fof(ax3_4965,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeoplewwaynelindacanadaright)),c_translation_6),c_basekb) )).

% Cyc Assertion #427355:
fof(ax3_4966,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1643991:
fof(ax3_4967,axiom,(
    collection(f_setoftypefn(c_sksicontentmicrotheory)) )).

% Cyc Assertion #1759464:
fof(ax3_4968,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_blogouter_courtcomegobrowsertim_allenhtml)),c_translation_27),c_basekb) )).

% Cyc Assertion #393450:
fof(ax3_4969,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_12),c_basekb) )).

% Cyc Assertion #1781194:
fof(ax3_4970,axiom,(
    genlmt(f_modelmtbyuserandtaskfn(c_akbuser,c_allotment_8),c_basekb) )).

% Cyc Assertion #326674:
fof(ax3_4971,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_21),c_basekb) )).

% Cyc Assertion #1494944:
fof(ax3_4972,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_30),c_basekb) )).

% Cyc Assertion #1172356:
fof(ax3_4973,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2178082:
fof(ax3_4974,axiom,(
    genlmt(c_tptp_member1787_mt,c_basekb) )).

% Cyc Assertion #798779:
fof(ax3_4975,axiom,(
    genlmt(c_mtbeforehormuzblocking,c_hpkbvocabmt) )).

% Cyc Assertion #2187958:
fof(ax3_4976,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_tptp_member3904_mt)
        & executionbyfiringsquad(TERM) )
     => tptp_9_210(TERM,f_relationallexistsfn(TERM,c_tptp_9_210,c_executionbyfiringsquad,c_tptpcol_16_30531)) ) )).

fof(ax3_4977,axiom,
    ( mtvisible(c_tptp_member3904_mt)
   => relationallexists(c_tptp_9_210,c_executionbyfiringsquad,c_tptpcol_16_30531) )).

% Cyc Assertion #1657782:
fof(ax3_4978,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreenselectcoukvisitoreditorial562html)),c_translation_12),c_basekb) )).

% Cyc Assertion #1632852:
fof(ax3_4979,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_librarydeltastateeduarchivesguidesoralhistorycivilrightspearson3html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1546322:
fof(ax3_4980,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_personwithoccupation,c_rider,f_subcollectionofwithrelationfromtypefn(c_transportationevent,c_subevents,c_rodeo)))
     => partiallytangible(OBJ) ) )).

fof(ax3_4981,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_personwithoccupation,c_rider,f_subcollectionofwithrelationfromtypefn(c_transportationevent,c_subevents,c_rodeo)),c_partiallytangible) )).

fof(ax3_4982,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnpersonwithoccupationridersubcollectionofwithrelationfromtypefntransportationeventsubeventsrodeo(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2177202:
fof(ax3_4983,axiom,(
    genlmt(c_tptp_member1567_mt,c_basekb) )).

% Cyc Assertion #475057:
fof(ax3_4984,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordrolandoffset0)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1538571:
fof(ax3_4985,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommrhtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1193937:
fof(ax3_4986,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwitvsorgoutsidelookinginfilmhtml)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #771558:
fof(ax3_4987,axiom,(
    genlmt(c_newtonssecondlawmt,c_basekb) )).

% Cyc Assertion #2179210:
fof(ax3_4988,axiom,(
    genlmt(c_tptp_member2069_mt,c_basekb) )).

% Cyc Assertion #2171358:
fof(ax3_4989,axiom,(
    genlmt(c_tptp_member106_mt,c_basekb) )).

% Cyc Assertion #590585:
fof(ax3_4990,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwjerrylentzcomarchive2003_06_01_archivehtml)),c_translation_26),c_basekb) )).

% Cyc Assertion #588048:
fof(ax3_4991,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiorgscanadianftppyorgscanadianchurch_of_the_creatorcanadaright)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1075459:
fof(ax3_4992,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcenedracomtpdavidlynch2htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1061391:
fof(ax3_4993,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmbugcoukdb293_9)),c_translation_33),c_basekb) )).

% Cyc Assertion #2179662:
fof(ax3_4994,axiom,(
    genlmt(c_tptp_member2182_mt,c_basekb) )).

% Cyc Assertion #850446:
fof(ax3_4995,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_qa_irans_nuclear_stand_off),c_basekb) )).

% Cyc Assertion #670331:
fof(ax3_4996,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwheritagepreservationorghhicase276html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1610005:
fof(ax3_4997,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsaramacomforumsshowthreadphpthreadid35479)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2180878:
fof(ax3_4998,axiom,(
    genlmt(c_tptp_member2486_mt,c_basekb) )).

% Cyc Assertion #2175906:
fof(ax3_4999,axiom,(
    genlmt(c_tptp_member1243_mt,c_basekb) )).

% Cyc Assertion #2179390:
fof(ax3_5000,axiom,(
    genlmt(c_tptp_member2114_mt,c_basekb) )).

% Cyc Assertion #1011733:
fof(ax3_5001,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationfromtypefn(c_enduringthing_localized,c_eventoccursat,c_event_localized))
     => enduringthing_localized(OBJ) ) )).

fof(ax3_5002,axiom,(
    genls(f_subcollectionofwithrelationfromtypefn(c_enduringthing_localized,c_eventoccursat,c_event_localized),c_enduringthing_localized) )).

fof(ax3_5003,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnenduringthing_localizedeventoccursatevent_localized(OBJ)
     => enduringthing_localized(OBJ) ) )).

% Cyc Assertion #2172950:
fof(ax3_5004,axiom,(
    genlmt(c_tptp_member504_mt,c_basekb) )).

% Cyc Assertion #2477652:
fof(ax3_5005,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x16_y9) )).

% Cyc Assertion #715931:
fof(ax3_5006,axiom,(
    arg2isa(c_userredirectapplicabilityproperty,c_setorcollection) )).

fof(ax3_5007,axiom,(
    ! [ARG1,ARG2] :
      ( userredirectapplicabilityproperty(ARG1,ARG2)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #144719:
fof(ax3_5008,axiom,(
    genlmt(c_reasoningaboutgrammaticalagreementmt,c_humansociallifemt) )).

% Cyc Assertion #452761:
fof(ax3_5009,axiom,(
    genlmt(c_ndu_denialandjeopardy_ch5mt,c_basekb) )).

% Cyc Assertion #1196831:
fof(ax3_5010,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycombenhecht)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1163155:
fof(ax3_5011,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwterrorismcentralcomlibrarybiographiesbioskahanekahanelisthtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #195154:
fof(ax3_5012,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpronigovukresearchlocalsimplehtm)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2482143:
fof(ax3_5013,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x51_y72) )).

% Cyc Assertion #2185511:
fof(ax3_5014,axiom,(
    genlmt(c_tptp_member3644_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1140753:
fof(ax3_5015,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmiamifilmfestivalcomjurorsasp)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2180966:
fof(ax3_5016,axiom,(
    genlmt(c_tptp_member2508_mt,c_basekb) )).

% Cyc Assertion #1767493:
fof(ax3_5017,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtopixnetmoviescat_people)),c_translation_33),c_basekb) )).

% Cyc Assertion #1150448:
fof(ax3_5018,axiom,(
    genlmt(c_publication936_pit,c_basekb) )).

% Cyc Assertion #2183554:
fof(ax3_5019,axiom,(
    genlmt(c_tptp_member3155_mt,c_basekb) )).

% Cyc Assertion #922315:
fof(ax3_5020,axiom,(
    genlmt(f_contextofpcwfn(c_unitedstatesmaritimelaw_coc),c_basekb) )).

% Cyc Assertion #303254:
fof(ax3_5021,axiom,(
    genlmt(c_nationalbriefings_iraqmt,c_basekb) )).

% Cyc Assertion #342734:
fof(ax3_5022,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1323600:
fof(ax3_5023,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgradewinnercomparticlesmi_m1285is_7_33ai_105735842)),c_translation_32),c_basekb) )).

% Cyc Assertion #2245114:
fof(ax3_5024,axiom,(
    genlmt(c_tptpfictionalcontext,c_basekb) )).

% Cyc Assertion #721384:
fof(ax3_5025,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrainglecomcommunitywikiphpusergizzerpagejuly)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #969509:
fof(ax3_5026,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_19),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175334:
fof(ax3_5027,axiom,(
    genlmt(c_tptp_member1100_mt,c_basekb) )).

% Cyc Assertion #261942:
fof(ax3_5028,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhitdvdnetdvdinfo8876reviews1)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1107751:
fof(ax3_5029,axiom,(
    genls(c_polyethyleneglycol_200,c_partiallytangible) )).

fof(ax3_5030,axiom,(
    ! [OBJ] :
      ( polyethyleneglycol_200(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1666308:
fof(ax3_5031,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive200409)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1647343:
fof(ax3_5032,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetcivilianprivateproperty(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1028782:
fof(ax3_5033,axiom,(
    genlmt(f_contextofpcwfn(c_thefoxandthegrapes_fable),c_basekb) )).

% Cyc Assertion #517665:
fof(ax3_5034,axiom,(
    individual(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_b00005y77pvglance)) )).

% Cyc Assertion #1249099:
fof(ax3_5035,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhgtvcomhgtvrm_restoration_homes_areasarticle01797hgtv_3787_137528800html)),c_translation_0),c_basekb) )).

% Cyc Assertion #1142793:
fof(ax3_5036,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstone_campbelljournalcomcurrentbookreviewsbreviewshtm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1424132:
fof(ax3_5037,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcanoecajammoviesartistsppreston_kellyhtml)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1494491:
fof(ax3_5038,axiom,(
    reflexivebinarypredicate(c_inregion) )).

% Cyc Assertion #1037007:
fof(ax3_5039,axiom,(
    genlmt(c_uia_automobiles_demoenvironmentmt,c_cycorpproductsmt) )).

% Cyc Assertion #2179526:
fof(ax3_5040,axiom,(
    genlmt(c_tptp_member2148_mt,c_basekb) )).

% Cyc Assertion #1802651:
fof(ax3_5041,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_32),c_basekb) )).

% Cyc Assertion #1986591:
fof(ax3_5042,axiom,(
    genls(c_tptpcol_1_65536,c_tptpcol_0_0) )).

fof(ax3_5043,axiom,(
    ! [OBJ] :
      ( tptpcol_1_65536(OBJ)
     => tptpcol_0_0(OBJ) ) )).

% Cyc Assertion #591968:
fof(ax3_5044,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsueduweaverrpagescastawayhtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #145255:
fof(ax3_5045,axiom,(
    genlmt(c_computerdatatypesdatamt,c_basekb) )).

% Cyc Assertion #1305994:
fof(ax3_5046,axiom,(
    genls(c_killingthroughdrowning,c_individual) )).

fof(ax3_5047,axiom,(
    ! [OBJ] :
      ( killingthroughdrowning(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #566225:
fof(ax3_5048,axiom,(
    genlmt(c_usmilitarypracticesmt,c_basekb) )).

% Cyc Assertion #1610721:
fof(ax3_5049,axiom,(
    microtheory(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbible_researchercomoldlatinhtml)),c_translation_33)) )).

% Cyc Assertion #270513:
fof(ax3_5050,axiom,(
    genlmt(f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_2000))),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #274592:
fof(ax3_5051,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #587902:
fof(ax3_5052,axiom,(
    genlmt(c_bpv_redfiresmt,c_basekb) )).

% Cyc Assertion #924782:
fof(ax3_5053,axiom,(
    genlmt(c_machinelearningspindleheadmt,c_ldscexperimentaltermsmt) )).

% Cyc Assertion #2178794:
fof(ax3_5054,axiom,(
    genlmt(c_tptp_member1965_mt,c_basekb) )).

% Cyc Assertion #1592024:
fof(ax3_5055,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0312290322vglance)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #947107:
fof(ax3_5056,axiom,(
    genls(c_nonplanarlinearobject_onedimensional,c_individual) )).

fof(ax3_5057,axiom,(
    ! [OBJ] :
      ( nonplanarlinearobject_onedimensional(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1139081:
fof(ax3_5058,axiom,(
    genlmt(c_bottledwaterdemoenvironmentmt,c_humansociallifemt) )).

% Cyc Assertion #1103710:
fof(ax3_5059,axiom,(
    genls(c_physicsproblem_constantacceleration,c_individual) )).

fof(ax3_5060,axiom,(
    ! [OBJ] :
      ( physicsproblem_constantacceleration(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #907014:
fof(ax3_5061,axiom,(
    genlmt(c_wabridgingmt,c_basekb) )).

% Cyc Assertion #1050529:
fof(ax3_5062,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_outdoornetcomnewsrockies2002_11_22html)),c_translation_2),c_basekb) )).

% Cyc Assertion #1646331:
fof(ax3_5063,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_monaco))
     => individual(OBJ) ) )).

fof(ax3_5064,axiom,(
    genls(f_residentfn(c_monaco),c_individual) )).

fof(ax3_5065,axiom,(
    ! [OBJ] :
      ( residentfnmonaco(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1725096:
fof(ax3_5066,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(f_organismparttypefn(c_bird,c_esophagus),c_derivedfrom,f_rootfn(c_potatoplant)))
     => partiallytangible(OBJ) ) )).

fof(ax3_5067,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(f_organismparttypefn(c_bird,c_esophagus),c_derivedfrom,f_rootfn(c_potatoplant)),c_partiallytangible) )).

fof(ax3_5068,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnorganismparttypefnbirdesophagusderivedfromrootfnpotatoplant(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #241512:
fof(ax3_5069,axiom,(
    genls(c_patriotterroristgroup,c_individual) )).

fof(ax3_5070,axiom,(
    ! [OBJ] :
      ( patriotterroristgroup(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #658997:
fof(ax3_5071,axiom,(
    genlmt(c_mtafterrastannurahattack,c_hpkbvocabmt) )).

% Cyc Assertion #241088:
fof(ax3_5072,axiom,(
    genlmt(c_americanfiscalpracticemt,c_basekb) )).

% Cyc Assertion #806194:
fof(ax3_5073,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_diagonallyorgforumviewtopicphpp98891sid30402306706f8b17405a36ee5f5f6846)),c_translation_0),c_basekb) )).

% Cyc Assertion #542971:
fof(ax3_5074,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_medeasmedialistsblueblogchcinema)),c_translation_33),c_basekb) )).

% Cyc Assertion #1044983:
fof(ax3_5075,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_vaccineforfn(c_thencmodifier))
     => partiallytangible(OBJ) ) )).

fof(ax3_5076,axiom,(
    genls(f_vaccineforfn(c_thencmodifier),c_partiallytangible) )).

fof(ax3_5077,axiom,(
    ! [OBJ] :
      ( vaccineforfnthencmodifier(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2189688:
fof(ax3_5078,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => tptptypes_9_693(f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma),c_tptpcol_16_26939) )).

% Cyc Assertion #1203552:
fof(ax3_5079,axiom,(
    genlmt(f_contentmtfn(c_cadre_agent_ks),c_basekb) )).

% Cyc Assertion #734293:
fof(ax3_5080,axiom,(
    genlmt(c_jacgeopoliticalissueontologymappingmt,c_basekb) )).

% Cyc Assertion #364823:
fof(ax3_5081,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpsychiatristcompccpccpdfv06s02v06s0203pdf)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1210165:
fof(ax3_5082,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwugaeducolumns100796info1html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1297572:
fof(ax3_5083,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumstelevisionwithoutpitycomindexphpshowtopic3113018)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1126865:
fof(ax3_5084,axiom,(
    genlmt(c_uia_worldleaders_demoenvironmentmt,c_peopledatamt) )).

% Cyc Assertion #1336817:
fof(ax3_5085,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoniclightcomconstablenotespdftituspdf)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1613005:
fof(ax3_5086,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpineycomfatchryshomixcolhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #2183482:
fof(ax3_5087,axiom,(
    genlmt(c_tptp_member3137_mt,c_basekb) )).

% Cyc Assertion #940254:
fof(ax3_5088,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikitum)),c_translation_3),c_basekb) )).

% Cyc Assertion #806531:
fof(ax3_5089,axiom,(
    genls(c_mathematicalobject,c_mathematicalthing) )).

fof(ax3_5090,axiom,(
    ! [OBJ] :
      ( mathematicalobject(OBJ)
     => mathematicalthing(OBJ) ) )).

% Cyc Assertion #250122:
fof(ax3_5091,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwestarkchurchofchristorgchadwell2004b040725htm)),c_translation_32),c_basekb) )).

% Cyc Assertion #1596494:
fof(ax3_5092,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrevolutionsfcomarticlehtmlid1281)),c_translation_0),c_basekb) )).

% Cyc Assertion #1190601:
fof(ax3_5093,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjamieleecurtisoffset0)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #465466:
fof(ax3_5094,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_14),c_basekb) )).

% Cyc Assertion #2237228:
fof(ax3_5095,axiom,
    ( mtvisible(c_cyclistsmt)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_55) )).

% Cyc Assertion #1613804:
fof(ax3_5096,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscreennameforumcomforumsindexphpshowtopic7873viewnew)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #136199:
fof(ax3_5097,axiom,(
    genlmt(c_bpv_salute_reportbackgroundmt,c_basekb) )).

% Cyc Assertion #2183590:
fof(ax3_5098,axiom,(
    genlmt(c_tptp_member3164_mt,c_basekb) )).

% Cyc Assertion #1066821:
fof(ax3_5099,axiom,(
    genlmt(c_reasoningwithmultifuture_inferencemt,c_basekb) )).

% Cyc Assertion #1186939:
fof(ax3_5100,axiom,(
    genlmt(f_contextofpcwfn(c_chargeprecedesarrest),c_basekb) )).

% Cyc Assertion #2182538:
fof(ax3_5101,axiom,(
    genlmt(c_tptp_member2901_mt,c_basekb) )).

% Cyc Assertion #2182490:
fof(ax3_5102,axiom,(
    genlmt(c_tptp_member2889_mt,c_basekb) )).

% Cyc Assertion #1253728:
fof(ax3_5103,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_anti_aircraftartilleryattack,c_actiononobject,s_34179ed1_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_5104,axiom,(
    genls(f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_anti_aircraftartilleryattack,c_actiononobject,s_34179ed1_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_5105,axiom,(
    ! [OBJ] :
      ( unsatisfactoryattempttofnpropersubcollectionnamedfn_ternaryanti_aircraftartilleryattackactiononobject34179ed1_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1226173:
fof(ax3_5106,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoneplacecomministriesinsight_for_livingarticleasparticle_id228)),c_translation_32),c_basekb) )).

% Cyc Assertion #1035609:
fof(ax3_5107,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiplacesftppyplacescanadacanadaright)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175414:
fof(ax3_5108,axiom,(
    genlmt(c_tptp_member1120_mt,c_basekb) )).

% Cyc Assertion #310397:
fof(ax3_5109,axiom,(
    genlmt(c_scenariotestmt_4,c_basekb) )).

% Cyc Assertion #1405812:
fof(ax3_5110,axiom,(
    genlmt(f_contextofpcwfn(c_pentateuch),c_basekb) )).

% Cyc Assertion #1605078:
fof(ax3_5111,axiom,(
    genlmt(f_lexicalmtforlanguagefn(c_moderngreeklanguage),c_basekb) )).

% Cyc Assertion #1108084:
fof(ax3_5112,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordhitsoffset0)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1542528:
fof(ax3_5113,axiom,(
    genlmt(f_modelmtbyuserandtaskfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),f_glassboxallotmentfn(s_e7dff3f0_099f_412b_bd76_51c9b4a540a7)),c_basekb) )).

% Cyc Assertion #2175394:
fof(ax3_5114,axiom,(
    genlmt(c_tptp_member1115_mt,c_basekb) )).

% Cyc Assertion #2185402:
fof(ax3_5115,axiom,(
    genlmt(c_tptp_member3617_mt,c_basekb) )).

% Cyc Assertion #1890277:
fof(ax3_5116,axiom,(
    genls(c_tptpcol_10_27013,c_tptpcol_9_26885) )).

fof(ax3_5117,axiom,(
    ! [OBJ] :
      ( tptpcol_10_27013(OBJ)
     => tptpcol_9_26885(OBJ) ) )).

% Cyc Assertion #1169404:
fof(ax3_5118,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmtrackscomcomposerswilliamsshtml)),c_translation_18),c_basekb) )).

% Cyc Assertion #1359399:
fof(ax3_5119,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororghwebpeoplewwayne_lindacanada_righthtml)),c_translation_7),c_basekb) )).

% Cyc Assertion #621204:
fof(ax3_5120,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmortgages_expocomalbany_mortgagehtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #482913:
fof(ax3_5121,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvcueduengwebeng384suicidehtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172986:
fof(ax3_5122,axiom,(
    genlmt(c_tptp_member513_mt,c_basekb) )).

% Cyc Assertion #1262748:
fof(ax3_5123,axiom,(
    genlmt(c_worldgeographyphysicalmt,c_worldgeographymt) )).

% Cyc Assertion #185959:
fof(ax3_5124,axiom,(
    genlmt(c_commercialbuyingmt,c_basekb) )).

% Cyc Assertion #381512:
fof(ax3_5125,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsearchgodswordorgcombccviewcgibookrochapter005)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #901842:
fof(ax3_5126,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtruluckcomhtmlabout_the_authorhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #677176:
fof(ax3_5127,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtvcomhome_improvementbackstage_passepisode23169summaryhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #912528:
fof(ax3_5128,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_memberstripodcomindygalfordtriviahtm)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1593798:
fof(ax3_5129,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_9),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1439833:
fof(ax3_5130,axiom,(
    genls(c_thankyouflowerarrangement,c_artifact) )).

fof(ax3_5131,axiom,(
    ! [OBJ] :
      ( thankyouflowerarrangement(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #332772:
fof(ax3_5132,axiom,(
    genlmt(c_cyclistsittingondockimt,c_basekb) )).

% Cyc Assertion #151746:
fof(ax3_5133,axiom,(
    genls(c_packagedobject,c_partiallytangible) )).

fof(ax3_5134,axiom,(
    ! [OBJ] :
      ( packagedobject(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1544194:
fof(ax3_5135,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_evaluatingvalueofwithrespecttofn(c_aspatialinformationstore,c_missionspecificationmicrotheory))
     => individual(OBJ) ) )).

fof(ax3_5136,axiom,(
    genls(f_evaluatingvalueofwithrespecttofn(c_aspatialinformationstore,c_missionspecificationmicrotheory),c_individual) )).

fof(ax3_5137,axiom,(
    ! [OBJ] :
      ( evaluatingvalueofwithrespecttofnaspatialinformationstoremissionspecificationmicrotheory(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2271212:
fof(ax3_5138,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => executionbyfiringsquad(c_tptpexecutionbyfiringsquad_75) )).

% Cyc Assertion #1086183:
fof(ax3_5139,axiom,(
    genlmt(c_keinteractionresourcetestmt,c_cbrne_gke_testmt) )).

% Cyc Assertion #566639:
fof(ax3_5140,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_15),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1248431:
fof(ax3_5141,axiom,(
    genlmt(c_pq223mt,c_basekb) )).

% Cyc Assertion #160091:
fof(ax3_5142,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_commentcolostateeduindexasppagedisplay_articlearticle_id698743591)),c_translation_3),c_basekb) )).

% Cyc Assertion #1284841:
fof(ax3_5143,axiom,(
    arg2isa(c_criterialforterraintacticalrole_negative,c_setorcollection) )).

fof(ax3_5144,axiom,(
    ! [ARG1,ARG2] :
      ( criterialforterraintacticalrole_negative(ARG1,ARG2)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #338646:
fof(ax3_5145,axiom,(
    genlmt(c_irsfaq3_6_8_pit,c_basekb) )).

% Cyc Assertion #703684:
fof(ax3_5146,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmafhoumcompress274p51htm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1386535:
fof(ax3_5147,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_joyfulmusictripodcompage4html)),c_translation_20),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1329662:
fof(ax3_5148,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumssjgamescomshowthreadphpt10319page2)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2181522:
fof(ax3_5149,axiom,(
    genlmt(c_tptp_member2647_mt,c_basekb) )).

% Cyc Assertion #534951:
fof(ax3_5150,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecruciblehtm)),c_translation_22),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1091469:
fof(ax3_5151,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetlinearobject_onedimensionallinearobject_nonplanar(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2179790:
fof(ax3_5152,axiom,(
    genlmt(c_tptp_member2214_mt,c_basekb) )).

% Cyc Assertion #1547747:
fof(ax3_5153,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertoffset0)),c_translation_27),c_basekb) )).

% Cyc Assertion #636641:
fof(ax3_5154,axiom,
    ( mtvisible(c_wordnetworkflowdatastatusmt)
   => wordnetsynsetimportstatus_readyforlexification(f_wordnetsynsetreifiedfn(n_579602)) )).

% Cyc Assertion #1681614:
fof(ax3_5155,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_newspaper_new_york_times_the_march_15_2006),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1672776:
fof(ax3_5156,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_131125260calendareventshtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1008876:
fof(ax3_5157,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_manager,c_controls,c_estate_legalentity))
     => individual(OBJ) ) )).

fof(ax3_5158,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_manager,c_controls,c_estate_legalentity),c_individual) )).

fof(ax3_5159,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnmanagercontrolsestate_legalentity(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2185868:
fof(ax3_5160,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member3733_mt) )).

% Cyc Assertion #655076:
fof(ax3_5161,axiom,(
    genlmt(c_informationsecuritymt,c_basekb) )).

% Cyc Assertion #1255567:
fof(ax3_5162,axiom,(
    genls(c_dairyproduct,c_artifact) )).

fof(ax3_5163,axiom,(
    ! [OBJ] :
      ( dairyproduct(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #2186218:
fof(ax3_5164,axiom,(
    genlmt(c_tptp_member3821_mt,c_basekb) )).

% Cyc Assertion #930248:
fof(ax3_5165,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfpcnorfolkorgsermonsmarch282004htm)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185438:
fof(ax3_5166,axiom,(
    genlmt(c_tptp_member3626_mt,c_basekb) )).

% Cyc Assertion #2062919:
fof(ax3_5167,axiom,(
    firstordercollection(c_tptpcol_16_96072) )).

% Cyc Assertion #605415:
fof(ax3_5168,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamb_usafrresourcesfranceusfamericans3htm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1338277:
fof(ax3_5169,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfyiottawacomcgi_binniveau2cgisfilmsp46055htmla1)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1261318:
fof(ax3_5170,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_scauwaterloocafashionarchiveshcos03hcos09cl)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173446:
fof(ax3_5171,axiom,(
    genlmt(c_tptp_member628_mt,c_basekb) )).

% Cyc Assertion #733764:
fof(ax3_5172,axiom,(
    genls(c_microtheory,c_aspatialinformationstore) )).

fof(ax3_5173,axiom,(
    ! [OBJ] :
      ( microtheory(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #2347436:
fof(ax3_5174,axiom,(
    isa(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_5497,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )).

fof(ax3_5175,axiom,(
    subcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_5497) )).

% Cyc Assertion #2477371:
fof(ax3_5176,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x5_y25) )).

% Cyc Assertion #769232:
fof(ax3_5177,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetleveeunderwaterlocation(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2182710:
fof(ax3_5178,axiom,(
    genlmt(c_tptp_member2944_mt,c_basekb) )).

% Cyc Assertion #585455:
fof(ax3_5179,axiom,(
    genlmt(c_mipt_terroristeventsmt,c_basekb) )).

% Cyc Assertion #2477124:
fof(ax3_5180,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_1(c_georegion_l1_x1_y0) )).

% Cyc Assertion #1042229:
fof(ax3_5181,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikibeloved_novel)),c_translation_2),c_basekb) )).

% Cyc Assertion #1631969:
fof(ax3_5182,axiom,(
    genls(c_padded,c_partiallytangible) )).

fof(ax3_5183,axiom,(
    ! [OBJ] :
      ( padded(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2179670:
fof(ax3_5184,axiom,(
    genlmt(c_tptp_member2184_mt,c_basekb) )).

% Cyc Assertion #809786:
fof(ax3_5185,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_meria_journal_article_israels_lebanon_policy),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #2271023:
fof(ax3_5186,axiom,(
    isa(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_2339,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)) )).

fof(ax3_5187,axiom,(
    subcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_2339) )).

% Cyc Assertion #978420:
fof(ax3_5188,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa2vd3cyoemj6sr_encodingutf8displaypublicpage11)),c_translation_32),c_basekb) )).

% Cyc Assertion #914515:
fof(ax3_5189,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwchroncomcontentchroniclefeaturesvideo97mainhtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #305836:
fof(ax3_5190,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnndbcompeople524000024452)),c_translation_33),c_basekb) )).

% Cyc Assertion #583547:
fof(ax3_5191,axiom,(
    genlmt(c_nooescapearchitecturemt,c_organizationdatamt) )).

% Cyc Assertion #1134869:
fof(ax3_5192,axiom,(
    genlmt(c_internationalsystemframeworkmt,c_hpkbvocabmt) )).

% Cyc Assertion #2480320:
fof(ax3_5193,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x29_y31) )).

% Cyc Assertion #2173990:
fof(ax3_5194,axiom,(
    genlmt(c_tptp_member764_mt,c_basekb) )).

% Cyc Assertion #2197459:
fof(ax3_5195,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_tptp_member516_mt)
        & isa(TERM,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )
     => tptp_8_89(TERM,f_relationallexistsfn(TERM,c_tptp_8_89,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_21566)) ) )).

fof(ax3_5196,axiom,
    ( mtvisible(c_tptp_member516_mt)
   => relationallexists(c_tptp_8_89,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent),c_tptpcol_16_21566) )).

% Cyc Assertion #525379:
fof(ax3_5197,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlondoncarealtyserviceseconomic_developmentind_buildingindustrialparkshtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175858:
fof(ax3_5198,axiom,(
    genlmt(c_tptp_member1231_mt,c_basekb) )).

% Cyc Assertion #583846:
fof(ax3_5199,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstartrekcomstartrekviewnewsarticle124354html)),c_translation_32),c_basekb) )).

% Cyc Assertion #960489:
fof(ax3_5200,axiom,(
    genlmt(c_naivespatialmt,c_basekb) )).

% Cyc Assertion #1462774:
fof(ax3_5201,axiom,(
    genlmt(c_attributecleanupmt,c_basekb) )).

% Cyc Assertion #2185050:
fof(ax3_5202,axiom,(
    genlmt(c_tptp_member3529_mt,c_basekb) )).

% Cyc Assertion #1455492:
fof(ax3_5203,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordcheroffset0)),c_translation_32),c_basekb) )).

% Cyc Assertion #1708931:
fof(ax3_5204,axiom,(
    genlmt(c_nimdformulatemplatesmt,c_basekb) )).

% Cyc Assertion #330942:
fof(ax3_5205,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2177330:
fof(ax3_5206,axiom,(
    genlmt(c_tptp_member1599_mt,c_basekb) )).

% Cyc Assertion #2185066:
fof(ax3_5207,axiom,(
    genlmt(c_tptp_member3533_mt,c_basekb) )).

% Cyc Assertion #2179634:
fof(ax3_5208,axiom,(
    genlmt(c_tptp_member2175_mt,c_basekb) )).

% Cyc Assertion #2185526:
fof(ax3_5209,axiom,(
    genlmt(c_tptp_member3648_mt,c_basekb) )).

% Cyc Assertion #962412:
fof(ax3_5210,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwchroncomcontentchroniclefeaturesvideo97mainhtml)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184722:
fof(ax3_5211,axiom,(
    genlmt(c_tptp_member3447_mt,c_basekb) )).

% Cyc Assertion #1529477:
fof(ax3_5212,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetancientwall_genericbarrier(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #958704:
fof(ax3_5213,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & isa(OBJ,f_chemicalsubstancefn(c_thiocyanateion)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_5214,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(f_chemicalsubstancefn(c_thiocyanateion),c_partiallytangible) )).

fof(ax3_5215,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & chemicalsubstancefnthiocyanateion(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1689102:
fof(ax3_5216,axiom,(
    genlmt(f_contextofpcwfn(c_apocrypha),c_basekb) )).

% Cyc Assertion #1371400:
fof(ax3_5217,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinfopleasecomipeaa0761438html)),c_translation_11),c_basekb) )).

% Cyc Assertion #2179114:
fof(ax3_5218,axiom,(
    genlmt(c_tptp_member2045_mt,c_basekb) )).

% Cyc Assertion #763253:
fof(ax3_5219,axiom,(
    genlmt(f_contentmtfn(c_nga_countryname_ks),c_basekb) )).

% Cyc Assertion #1598308:
fof(ax3_5220,axiom,(
    genlmt(c_alaska_hawaiitimezonevocabularymt,c_basekb) )).

% Cyc Assertion #1165175:
fof(ax3_5221,axiom,(
    genlmt(f_contentmtfn(c_nga_regionnames_ks),c_basekb) )).

% Cyc Assertion #313104:
fof(ax3_5222,axiom,(
    individual(c_kimcarnes) )).

% Cyc Assertion #311831:
fof(ax3_5223,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpowellscomsubsectionaudiobooksbiographies4html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2175066:
fof(ax3_5224,axiom,(
    genlmt(c_tptp_member1033_mt,c_basekb) )).

% Cyc Assertion #715336:
fof(ax3_5225,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwscoopconzstoriespa0205s00575htm)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1126013:
fof(ax3_5226,axiom,(
    genlmt(c_businessstubmt,c_basekb) )).

% Cyc Assertion #810400:
fof(ax3_5227,axiom,(
    genls(c_dream,c_aspatialinformationstore) )).

fof(ax3_5228,axiom,(
    ! [OBJ] :
      ( dream(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1285559:
fof(ax3_5229,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dmozorgartsmoviestitlesgdeschtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #441232:
fof(ax3_5230,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcommongroundcommonsenseorgforumsindexphpshowtopic10194viewgetlastpost)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2174442:
fof(ax3_5231,axiom,(
    genlmt(c_tptp_member877_mt,c_basekb) )).

% Cyc Assertion #1480445:
fof(ax3_5232,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_13),c_basekb) )).

% Cyc Assertion #713464:
fof(ax3_5233,axiom,(
    genlmt(f_contextofpcwfn(c_hezbollahintelreport),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1276988:
fof(ax3_5234,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcancercouncilcomauhtmlschoolsandcommunitiesschoolsandchildcareschoolresourceshp_skincancerpdf)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1675940:
fof(ax3_5235,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdrgeorgestretchcomarticlesdetailaspid4)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2169008:
fof(ax3_5236,axiom,(
    ! [ARG1,ARG2] :
      ( tptp_7_46(ARG1,ARG2)
     => isa(ARG2,f_endingfn(c_war)) ) )).

fof(ax3_5237,axiom,(
    arg2isa(c_tptp_7_46,f_endingfn(c_war)) )).

fof(ax3_5238,axiom,(
    ! [ARG1,ARG2] :
      ( tptp_7_46(ARG1,ARG2)
     => endingfnwar(ARG2) ) )).

% Cyc Assertion #350594:
fof(ax3_5239,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvisionrxcomlibraryencenc_eyelidcanasp)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2171866:
fof(ax3_5240,axiom,(
    genlmt(c_tptp_member233_mt,c_basekb) )).

% Cyc Assertion #200756:
fof(ax3_5241,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmuslimhopecombibleanswerstthtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #913356:
fof(ax3_5242,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_quinnelluspersonalmiscrandomhtml)),c_translation_16),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1239607:
fof(ax3_5243,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrotteneggscomrshowse2859780html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2257971:
fof(ax3_5244,axiom,(
    individual(c_tptpslum_14) )).

% Cyc Assertion #1706514:
fof(ax3_5245,axiom,(
    genlmt(c_cyclistsmt,c_calendarsmt) )).

% Cyc Assertion #1721725:
fof(ax3_5246,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthedailybulletincompostcardsmar9chtm)),c_translation_12),c_basekb) )).

% Cyc Assertion #447439:
fof(ax3_5247,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_28),c_basekb) )).

% Cyc Assertion #1236852:
fof(ax3_5248,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_schoolteacher,c_affiliatedwith,c_regionalgovernment))
     => individual(OBJ) ) )).

fof(ax3_5249,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_schoolteacher,c_affiliatedwith,c_regionalgovernment),c_individual) )).

fof(ax3_5250,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnschoolteacheraffiliatedwithregionalgovernment(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2184995:
fof(ax3_5251,axiom,(
    genlmt(c_tptp_member3515_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #395753:
fof(ax3_5252,axiom,(
    genlmt(c_networktestsoftwaremt,c_basekb) )).

% Cyc Assertion #1385870:
fof(ax3_5253,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_0),c_basekb) )).

% Cyc Assertion #2183586:
fof(ax3_5254,axiom,(
    genlmt(c_tptp_member3163_mt,c_basekb) )).

% Cyc Assertion #878350:
fof(ax3_5255,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsteamboatcomwinter_intaspxcategoryid254)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1160316:
fof(ax3_5256,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_0),c_basekb) )).

% Cyc Assertion #1638429:
fof(ax3_5257,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_s6invisionfreecom80s_cartoonsindexphpshowtopic2854viewgetnewpost)),c_translation_32),c_basekb) )).

% Cyc Assertion #1680281:
fof(ax3_5258,axiom,(
    ! [OBJ] :
      ( collectiondifferencefnthingcollectionunionfnthesetoctopusmalehumanfemalehuman(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1685526:
fof(ax3_5259,axiom,(
    defaultmonotonicpredicate(c_genlmt) )).

% Cyc Assertion #2176250:
fof(ax3_5260,axiom,(
    genlmt(c_tptp_member1329_mt,c_basekb) )).

% Cyc Assertion #168421:
fof(ax3_5261,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_infoguatguatemalaorgedition3_2004htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #1778479:
fof(ax3_5262,axiom,
    ( mtvisible(c_englishmt)
   => prettystring(f_propersubcollectionnamedfn_ternary(s_trainingfacility,c_partiallytangible,s_3413ce42_f4ed_11d9_9bea_0002b3a85b0b),s_typeoftangiblethingnamedtrainingfacility) )).

% Cyc Assertion #415287:
fof(ax3_5263,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_security_council_declares_support_for_free_fair_presidential_elections_in_lebanon),c_basekb) )).

% Cyc Assertion #1166315:
fof(ax3_5264,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_ww2moviefreebiecom_8567moviessome20folks20call20it20a20sling20bladeasb00005uo7f)),c_translation_32),c_basekb) )).

% Cyc Assertion #2172042:
fof(ax3_5265,axiom,(
    genlmt(c_tptp_member277_mt,c_basekb) )).

% Cyc Assertion #719743:
fof(ax3_5266,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkaraokeinfocoukforumforum_postsasptid887tpn2)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2176462:
fof(ax3_5267,axiom,(
    genlmt(c_tptp_member1382_mt,c_basekb) )).

% Cyc Assertion #494250:
fof(ax3_5268,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcolumbusalivecom200020000406music1html)),c_translation_24),c_basekb) )).

% Cyc Assertion #189169:
fof(ax3_5269,axiom,(
    genlmt(c_textlearnerprocessesmt,c_basekb) )).

% Cyc Assertion #949801:
fof(ax3_5270,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_shswestportk12ctusrexjournalismjournalismhtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #535722:
fof(ax3_5271,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_anti_syrian_appointed_lebanon_pm),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #2186010:
fof(ax3_5272,axiom,(
    genlmt(c_tptp_member3769_mt,c_basekb) )).

% Cyc Assertion #2178390:
fof(ax3_5273,axiom,(
    genlmt(c_tptp_member1864_mt,c_basekb) )).

% Cyc Assertion #1706578:
fof(ax3_5274,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_tenniscourt))
     => partiallytangible(OBJ) ) )).

fof(ax3_5275,axiom,(
    genls(f_groupfn(c_tenniscourt),c_partiallytangible) )).

fof(ax3_5276,axiom,(
    ! [OBJ] :
      ( groupfntenniscourt(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #685424:
fof(ax3_5277,axiom,(
    genlmt(c_biologicalchemistryvocabularymt,c_basekb) )).

% Cyc Assertion #1207577:
fof(ax3_5278,axiom,(
    genlmt(c_y1phase1_stage2mt,c_basekb) )).

% Cyc Assertion #325817:
fof(ax3_5279,axiom,(
    genls(c_reticulum_venusian,c_individual) )).

fof(ax3_5280,axiom,(
    ! [OBJ] :
      ( reticulum_venusian(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2181983:
fof(ax3_5281,axiom,(
    genlmt(c_tptp_member2762_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1099523:
fof(ax3_5282,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_spleenvillecomlilith33blogmt_commentscgientry_id7948)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #346990:
fof(ax3_5283,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0870541811vglance)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2178166:
fof(ax3_5284,axiom,(
    genlmt(c_tptp_member1808_mt,c_basekb) )).

% Cyc Assertion #842274:
fof(ax3_5285,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcanflixcomproductdetailaspxitem12245searchqcast3dbilly2bbob2bthornton)),c_translation_31),c_basekb) )).

% Cyc Assertion #2180378:
fof(ax3_5286,axiom,(
    genlmt(c_tptp_member2361_mt,c_basekb) )).

% Cyc Assertion #2334123:
fof(ax3_5287,axiom,(
    isa(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_3847,f_subcollectionofwithrelationtofn(c_ship,c_objectfoundinlocation,c_cityofbostonma)) )).

fof(ax3_5288,axiom,(
    subcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma(c_tptpnsubcollectionofwithrelationtofnshipobjectfoundinlocationcityofbostonma_3847) )).

% Cyc Assertion #808465:
fof(ax3_5289,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaaaeventscoukforumsview_topicphpid1439forum_id24page3)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #907524:
fof(ax3_5290,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgiplacesftppyplacescanadacanadaright)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1889958:
fof(ax3_5291,axiom,(
    genls(c_tptpcol_9_26885,c_tptpcol_8_26629) )).

fof(ax3_5292,axiom,(
    ! [OBJ] :
      ( tptpcol_9_26885(OBJ)
     => tptpcol_8_26629(OBJ) ) )).

% Cyc Assertion #1301544:
fof(ax3_5293,axiom,(
    proposaltypebystatus(c_awaitingconfirmation) )).

% Cyc Assertion #1642357:
fof(ax3_5294,axiom,(
    genlmt(c_easterntimezonemt,c_basekb) )).

% Cyc Assertion #1194585:
fof(ax3_5295,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_residentfn(c_france))
     => individual(OBJ) ) )).

fof(ax3_5296,axiom,(
    genls(f_residentfn(c_france),c_individual) )).

fof(ax3_5297,axiom,(
    ! [OBJ] :
      ( residentfnfrance(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2483310:
fof(ax3_5298,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x66_y24) )).

% Cyc Assertion #796883:
fof(ax3_5299,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newssurfwaxcomtvfilescybill_tvhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #638333:
fof(ax3_5300,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19223)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1052052:
fof(ax3_5301,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(f_subcollectionofwithrelationtofn(c_issue,c_topicofindividual,c_security_emotion),c_topicofindividual,c_terroristact))
     => individual(OBJ) ) )).

fof(ax3_5302,axiom,(
    genls(f_subcollectionofwithrelationtofn(f_subcollectionofwithrelationtofn(c_issue,c_topicofindividual,c_security_emotion),c_topicofindividual,c_terroristact),c_individual) )).

fof(ax3_5303,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnsubcollectionofwithrelationtofnissuetopicofindividualsecurity_emotiontopicofindividualterroristact(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2171486:
fof(ax3_5304,axiom,(
    genlmt(c_tptp_member138_mt,c_basekb) )).

% Cyc Assertion #2491863:
fof(ax3_5305,axiom,
    ( mtvisible(c_tptpgeo_member2_mt)
   => geographicalsubregions(c_georegion_l2_x8_y2,c_georegion_l3_x26_y8) )).

% Cyc Assertion #805249:
fof(ax3_5306,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwaskmencomwomen2002_top_9953html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1473803:
fof(ax3_5307,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpbsorgwnetamericanmastersdylanindex12html)),c_translation_32),c_basekb) )).

% Cyc Assertion #174794:
fof(ax3_5308,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_diphenylarsineoxide,c_partiallytangible) )).

fof(ax3_5309,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & diphenylarsineoxide(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1303665:
fof(ax3_5310,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororghwebpeoplewwayne_lindacanada_righthtml)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184298:
fof(ax3_5311,axiom,(
    genlmt(c_tptp_member3341_mt,c_basekb) )).

% Cyc Assertion #901769:
fof(ax3_5312,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpenpushercomclientssamplesatlantahtml)),c_translation_30),c_basekb) )).

% Cyc Assertion #2182298:
fof(ax3_5313,axiom,(
    genlmt(c_tptp_member2841_mt,c_basekb) )).

% Cyc Assertion #849734:
fof(ax3_5314,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovieseercomactorprofilebilaspaid285channel2)),c_translation_22),c_basekb) )).

% Cyc Assertion #670314:
fof(ax3_5315,axiom,(
    disjointwith(c_intangible,c_partiallytangible) )).

fof(ax3_5316,axiom,(
    ! [OBJ] :
      ~ ( intangible(OBJ)
        & partiallytangible(OBJ) ) )).

% Cyc Assertion #915871:
fof(ax3_5317,axiom,(
    physicalorderingpredicate(c_properlyspatiallysubsumes_nontangential) )).

% Cyc Assertion #1727388:
fof(ax3_5318,axiom,(
    genls(c_dipole,c_partiallytangible) )).

fof(ax3_5319,axiom,(
    ! [OBJ] :
      ( dipole(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1181624:
fof(ax3_5320,axiom,(
    genls(c_configurationtypebycomplexity,c_collection) )).

fof(ax3_5321,axiom,(
    ! [OBJ] :
      ( configurationtypebycomplexity(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #2185351:
fof(ax3_5322,axiom,(
    genlmt(c_tptp_member3604_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1129417:
fof(ax3_5323,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_profile__mahmoud_amadinejad),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #2057155:
fof(ax3_5324,axiom,(
    genls(c_tptpcol_12_93765,c_tptpcol_11_93764) )).

fof(ax3_5325,axiom,(
    ! [OBJ] :
      ( tptpcol_12_93765(OBJ)
     => tptpcol_11_93764(OBJ) ) )).

% Cyc Assertion #1320934:
fof(ax3_5326,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwxcapewithuscomhot_dealshotels_in_city_of_andorra_la_vellahotel_floraasp)),c_translation_33),c_basekb) )).

% Cyc Assertion #1451495:
fof(ax3_5327,axiom,(
    genlmt(c_pq238mt,c_basekb) )).

% Cyc Assertion #1302099:
fof(ax3_5328,axiom,(
    genls(c_sulfurhexafluoride,c_partiallytangible) )).

fof(ax3_5329,axiom,(
    ! [OBJ] :
      ( sulfurhexafluoride(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1168877:
fof(ax3_5330,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_lifsostypepadcomlulled_into_a_false_sense200509)),c_translation_1),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1410870:
fof(ax3_5331,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwzmagorgzmagzarticlecfmurlarticlesmartinezjume98htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #702906:
fof(ax3_5332,axiom,(
    genlmt(c_naivebiologicaldescentmt,c_basekb) )).

% Cyc Assertion #477466:
fof(ax3_5333,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwvwebsitescomweatherny_weatherphp)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2183226:
fof(ax3_5334,axiom,(
    genlmt(c_tptp_member3073_mt,c_basekb) )).

% Cyc Assertion #1450413:
fof(ax3_5335,axiom,
    ( mtvisible(c_cycnounlearnermt)
   => genls(c_limelight,c_intangibleindividual) )).

fof(ax3_5336,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_cycnounlearnermt)
        & limelight(OBJ) )
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #1619152:
fof(ax3_5337,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_jdlorgilabouthtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #169754:
fof(ax3_5338,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #224795:
fof(ax3_5339,axiom,(
    genlmt(c_individualhumanactivitiesmt,c_basekb) )).

% Cyc Assertion #302223:
fof(ax3_5340,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_producthalfebaycomthe_great_gatsby_w0qqprz11947qqtgzinfo)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1243931:
fof(ax3_5341,axiom,(
    arg1isa(c_most,c_setorcollection) )).

fof(ax3_5342,axiom,(
    ! [ARG1,ARG2] :
      ( most(ARG1,ARG2)
     => setorcollection(ARG1) ) )).

% Cyc Assertion #381941:
fof(ax3_5343,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwkjv1611orgukwho20wrote20the20book20of20hebrewshtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #605480:
fof(ax3_5344,axiom,(
    genls(c_financialfacility,c_individual) )).

fof(ax3_5345,axiom,(
    ! [OBJ] :
      ( financialfacility(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1143131:
fof(ax3_5346,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_educationyahoocomhomework_helpcliffsnotesthe_joy_luck_club7html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2174903:
fof(ax3_5347,axiom,(
    genlmt(c_tptp_member992_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #343636:
fof(ax3_5348,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwalternetorgdrugreporter29113)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2479865:
fof(ax3_5349,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x23_y62) )).

% Cyc Assertion #448371:
fof(ax3_5350,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_modernmilitaryunit_deployable,c_institutionalfocus,c_russianperson))
     => individual(OBJ) ) )).

fof(ax3_5351,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_modernmilitaryunit_deployable,c_institutionalfocus,c_russianperson),c_individual) )).

fof(ax3_5352,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnmodernmilitaryunit_deployableinstitutionalfocusrussianperson(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1603377:
fof(ax3_5353,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrensecomgeneral18militantjewishactivistshtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1147672:
fof(ax3_5354,axiom,(
    genls(c_cleanupofderivedfrom,c_individual) )).

fof(ax3_5355,axiom,(
    ! [OBJ] :
      ( cleanupofderivedfrom(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1430680:
fof(ax3_5356,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_nunatak))
     => partiallytangible(OBJ) ) )).

fof(ax3_5357,axiom,(
    genls(f_groupfn(c_nunatak),c_partiallytangible) )).

fof(ax3_5358,axiom,(
    ! [OBJ] :
      ( groupfnnunatak(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1787988:
fof(ax3_5359,axiom,(
    individual(f_computervulnerabilityreportfn(c_bugtraqfaultdatabase,s_1396)) )).

% Cyc Assertion #2175611:
fof(ax3_5360,axiom,(
    genlmt(c_tptp_member1169_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1016367:
fof(ax3_5361,axiom,(
    genls(c_unconfirmedbugzillabugreport,c_individual) )).

fof(ax3_5362,axiom,(
    ! [OBJ] :
      ( unconfirmedbugzillabugreport(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #974545:
fof(ax3_5363,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfyiottawacomcgi_binniveau2cgisfilmsp46055htmla1)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #310885:
fof(ax3_5364,axiom,(
    genlmt(c_glfexpansionsmt,c_basekb) )).

% Cyc Assertion #157740:
fof(ax3_5365,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dbetreeorgmyshowsphpuseridleigh8181)),c_translation_26),c_basekb) )).

% Cyc Assertion #209003:
fof(ax3_5366,axiom,(
    genlmt(c_pq98_99mt,c_basekb) )).

% Cyc Assertion #2173722:
fof(ax3_5367,axiom,(
    genlmt(c_tptp_member697_mt,c_basekb) )).

% Cyc Assertion #2172942:
fof(ax3_5368,axiom,(
    genlmt(c_tptp_member502_mt,c_basekb) )).

% Cyc Assertion #1075328:
fof(ax3_5369,axiom,(
    ! [OBJ] :
      ( collectiondifferencefnkbcontenttest_fullyspecifiedsksicontenttest(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1266065:
fof(ax3_5370,axiom,(
    genlmt(c_attackoperationsontologymappingmt,c_basekb) )).

% Cyc Assertion #1071396:
fof(ax3_5371,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmurkfamilyministriesorgthoughtslovech2html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #810720:
fof(ax3_5372,axiom,(
    genlmt(c_babyatpoolimt,c_basekb) )).

% Cyc Assertion #2172182:
fof(ax3_5373,axiom,(
    genlmt(c_tptp_member312_mt,c_basekb) )).

% Cyc Assertion #186063:
fof(ax3_5374,axiom,(
    genls(c_audittrail,c_individual) )).

fof(ax3_5375,axiom,(
    ! [OBJ] :
      ( audittrail(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1648758:
fof(ax3_5376,axiom,(
    genlmt(c_testimonyofjamalahmedal_fadlmt,c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #1562605:
fof(ax3_5377,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthedailybulletincompostcardsmar9chtm)),c_translation_7),c_basekb) )).

% Cyc Assertion #2178046:
fof(ax3_5378,axiom,(
    genlmt(c_tptp_member1778_mt,c_basekb) )).

% Cyc Assertion #1638509:
fof(ax3_5379,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_underprivileged,c_thing,s_33f1ee65_f4ed_11d9_9bea_0002b3a85b0b))
     => thing(OBJ) ) )).

fof(ax3_5380,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_underprivileged,c_thing,s_33f1ee65_f4ed_11d9_9bea_0002b3a85b0b),c_thing) )).

fof(ax3_5381,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryunderprivilegedthing33f1ee65_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1778207:
fof(ax3_5382,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #235126:
fof(ax3_5383,axiom,(
    genls(c_tube_tangible,c_partiallytangible) )).

fof(ax3_5384,axiom,(
    ! [OBJ] :
      ( tube_tangible(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1002716:
fof(ax3_5385,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwneverarycomn1n1umbrellahtm)),c_translation_6),c_basekb) )).

% Cyc Assertion #2176230:
fof(ax3_5386,axiom,(
    genlmt(c_tptp_member1324_mt,c_basekb) )).

% Cyc Assertion #1232124:
fof(ax3_5387,axiom,(
    genls(c_chop_meatcut,c_artifact) )).

fof(ax3_5388,axiom,(
    ! [OBJ] :
      ( chop_meatcut(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #542066:
fof(ax3_5389,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomrealmsofwisdomfantasyfantasy1html)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1350611:
fof(ax3_5390,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_22),c_basekb) )).

% Cyc Assertion #1641465:
fof(ax3_5391,axiom,(
    genls(c_eonodenothandledyet,c_thing) )).

fof(ax3_5392,axiom,(
    ! [OBJ] :
      ( eonodenothandledyet(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #263152:
fof(ax3_5393,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1002081:
fof(ax3_5394,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikiuser_niteowlneilsactors_a_b)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1774097:
fof(ax3_5395,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinfidelsorglibrarymodernfarrell_tillgeisler_tillgeisler1html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2185102:
fof(ax3_5396,axiom,(
    genlmt(c_tptp_member3542_mt,c_basekb) )).

% Cyc Assertion #2184470:
fof(ax3_5397,axiom,(
    genlmt(c_tptp_member3384_mt,c_basekb) )).

% Cyc Assertion #1228218:
fof(ax3_5398,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordhitsoffset0)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #460380:
fof(ax3_5399,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordjudygarlandoffset0)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #302212:
fof(ax3_5400,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive20040915n61crtr29jarhtm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #567996:
fof(ax3_5401,axiom,(
    genlmt(c_bpv_redoccupiesmt,c_basekb) )).

% Cyc Assertion #906222:
fof(ax3_5402,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_15),c_basekb) )).

% Cyc Assertion #178959:
fof(ax3_5403,axiom,(
    genlmt(c_battlespacemilitarymt,c_basekb) )).

% Cyc Assertion #346756:
fof(ax3_5404,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_29),c_basekb) )).

% Cyc Assertion #881603:
fof(ax3_5405,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmegaessayscomviewpaper83347html)),c_translation_30),c_basekb) )).

% Cyc Assertion #1473527:
fof(ax3_5406,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_cliff))
     => partiallytangible(OBJ) ) )).

fof(ax3_5407,axiom,(
    genls(f_groupfn(c_cliff),c_partiallytangible) )).

fof(ax3_5408,axiom,(
    ! [OBJ] :
      ( groupfncliff(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #816914:
fof(ax3_5409,axiom,(
    genlmt(f_contextofpcwfn(c_foodanddrinktaxonomy),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1137157:
fof(ax3_5410,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_technician,c_domainsofspecialization,c_elevator))
     => partiallytangible(OBJ) ) )).

fof(ax3_5411,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_technician,c_domainsofspecialization,c_elevator),c_partiallytangible) )).

fof(ax3_5412,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofntechniciandomainsofspecializationelevator(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #821996:
fof(ax3_5413,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_b0000cbl7avglance)),c_translation_28),c_basekb) )).

% Cyc Assertion #957435:
fof(ax3_5414,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_hbcuconnectcomcafeviewtopicphpp242533sidc133e1caf8fa995974e8af9052fd75e5)),c_translation_32),c_basekb) )).

% Cyc Assertion #1291911:
fof(ax3_5415,axiom,
    ( mtvisible(c_languageandwritingsystemvocabularymt)
   => livinglanguage(c_utelanguage) )).

% Cyc Assertion #2176190:
fof(ax3_5416,axiom,(
    genlmt(c_tptp_member1314_mt,c_basekb) )).

% Cyc Assertion #273173:
fof(ax3_5417,axiom,(
    genlmt(c_containergmt,c_basekb) )).

% Cyc Assertion #1230891:
fof(ax3_5418,axiom,(
    genls(c_decreaseaction,c_individual) )).

fof(ax3_5419,axiom,(
    ! [OBJ] :
      ( decreaseaction(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2171966:
fof(ax3_5420,axiom,(
    genlmt(c_tptp_member258_mt,c_basekb) )).

% Cyc Assertion #2179998:
fof(ax3_5421,axiom,(
    genlmt(c_tptp_member2266_mt,c_basekb) )).

% Cyc Assertion #1055765:
fof(ax3_5422,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_currentworlddatacollectormt_nonhomocentric) )).

% Cyc Assertion #1561868:
fof(ax3_5423,axiom,(
    genlmt(c_indigenousorganismdualistdatavocabularymt,c_basekb) )).

% Cyc Assertion #1766677:
fof(ax3_5424,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_facilitytypeoforganizationtypefn(c_tannery_organization))
     => partiallytangible(OBJ) ) )).

fof(ax3_5425,axiom,(
    genls(f_facilitytypeoforganizationtypefn(c_tannery_organization),c_partiallytangible) )).

fof(ax3_5426,axiom,(
    ! [OBJ] :
      ( facilitytypeoforganizationtypefntannery_organization(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #730880:
fof(ax3_5427,axiom,(
    genls(c_beliefsystemmicrotheory,c_microtheory) )).

fof(ax3_5428,axiom,(
    ! [OBJ] :
      ( beliefsystemmicrotheory(OBJ)
     => microtheory(OBJ) ) )).

% Cyc Assertion #1008327:
fof(ax3_5429,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleadingauthoritiescomtalentaallen_debbieallen_debbiedoc)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1095813:
fof(ax3_5430,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_terrorismtacticsmt) )).

% Cyc Assertion #765701:
fof(ax3_5431,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvillagevoicecomissues0419davisphp)),c_translation_33),c_basekb) )).

% Cyc Assertion #2195556:
fof(ax3_5432,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
        & isa(TERM,f_subcollectionofwithrelationtotypefn(c_issuingaprescription,c_products,c_correctivelensprescription)) )
     => tptp_8_968(f_relationexistsallfn(TERM,c_tptp_8_968,c_tptpcol_16_7294,f_subcollectionofwithrelationtotypefn(c_issuingaprescription,c_products,c_correctivelensprescription)),TERM) ) )).

fof(ax3_5433,axiom,
    ( mtvisible(c_currentworlddatacollectormt_nonhomocentric)
   => relationexistsall(c_tptp_8_968,c_tptpcol_16_7294,f_subcollectionofwithrelationtotypefn(c_issuingaprescription,c_products,c_correctivelensprescription)) )).

% Cyc Assertion #273370:
fof(ax3_5434,axiom,(
    genlmt(c_englishgrammartemplatemt,c_basekb) )).

% Cyc Assertion #1027587:
fof(ax3_5435,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_ciaworldfactbook1996mt) )).

% Cyc Assertion #1450523:
fof(ax3_5436,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationfromtypefnwall_verticalproperphysicalpartscollectionunionfnthesetmine_excavationfacilityquarry(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #159575:
fof(ax3_5437,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_masseventoftypefn(c_vandalism))
     => individual(OBJ) ) )).

fof(ax3_5438,axiom,(
    genls(f_masseventoftypefn(c_vandalism),c_individual) )).

fof(ax3_5439,axiom,(
    ! [OBJ] :
      ( masseventoftypefnvandalism(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #239285:
fof(ax3_5440,axiom,(
    genlmt(c_peopledatamt,c_literarypeopledatamt) )).

% Cyc Assertion #857542:
fof(ax3_5441,axiom,
    ( mtvisible(c_chemistryvocabularymt)
   => genls(c_pentaerythritol,c_partiallytangible) )).

fof(ax3_5442,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_chemistryvocabularymt)
        & pentaerythritol(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #393907:
fof(ax3_5443,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwepinionscomcontent_106804514436)),c_translation_32),c_basekb) )).

% Cyc Assertion #1450887:
fof(ax3_5444,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnizkororgftpcgipeopleaandrewsdonaldftppypeopleaandrewsdonaldcanadaright)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1167099:
fof(ax3_5445,axiom,(
    genls(c_nationalpark_nps,c_partiallytangible) )).

fof(ax3_5446,axiom,(
    ! [OBJ] :
      ( nationalpark_nps(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #679788:
fof(ax3_5447,axiom,(
    genlmt(c_imdb_querymt,c_testvocabularymt) )).

% Cyc Assertion #1540311:
fof(ax3_5448,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwpoweripodsearchinfobrown_ipodhtml)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1122274:
fof(ax3_5449,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikiuser_niteowlneilsactors_a_b)),c_translation_1),c_basekb) )).

% Cyc Assertion #1561796:
fof(ax3_5450,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstpuheduvol6772shobizshobiz_indexhtml)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #923044:
fof(ax3_5451,axiom,(
    genlmt(c_tptp_pla001_1_problemmt,c_basekb) )).

% Cyc Assertion #1451903:
fof(ax3_5452,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_the_cruciblebiographyms)),c_translation_0),c_basekb) )).

% Cyc Assertion #523500:
fof(ax3_5453,axiom,(
    genlmt(c_housemt,c_unitedstatessociallifemt) )).

% Cyc Assertion #271846:
fof(ax3_5454,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordozoffset0)),c_translation_28),c_basekb) )).

% Cyc Assertion #642711:
fof(ax3_5455,axiom,(
    genlmt(c_testimonyofjamalahmedal_fadlmt,c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #163248:
fof(ax3_5456,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwuniversitysportcaestory_detailcfmid6284)),c_translation_8),c_basekb) )).

% Cyc Assertion #810432:
fof(ax3_5457,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_reviewsauthorstorecom200504an_anonymous_auhtml)),c_translation_15),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1535652:
fof(ax3_5458,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmoviemakercomissues05videohtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #518539:
fof(ax3_5459,axiom,(
    genlmt(c_ldscdemonstrationspindleheadmt,c_currentworlddatacollectormt_nonhomocentric) )).

% Cyc Assertion #1488908:
fof(ax3_5460,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_accessoryfn_artifact(c_canoe))
     => artifact(OBJ) ) )).

fof(ax3_5461,axiom,(
    genls(f_accessoryfn_artifact(c_canoe),c_artifact) )).

fof(ax3_5462,axiom,(
    ! [OBJ] :
      ( accessoryfn_artifactcanoe(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1747530:
fof(ax3_5463,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlittlegreenfootballscomweblogentry8973)),c_translation_29),c_basekb) )).

% Cyc Assertion #553368:
fof(ax3_5464,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwworkingwonderscomaucontentactiongetfileid87)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1277827:
fof(ax3_5465,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhawaiifilmofficecompdfhollywood_tropicalpdf)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1166313:
fof(ax3_5466,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvaldostaedujmmarshkidshtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #962221:
fof(ax3_5467,axiom,(
    ! [OBJ] :
      ( collectionsubsetfnpersonthesetofpersonambassadorfromtopersonindiaromania(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #894625:
fof(ax3_5468,axiom,(
    genlmt(f_contextofpcwfn(c_communityreinvestmentact),c_humansociallifemt) )).

% Cyc Assertion #2179238:
fof(ax3_5469,axiom,(
    genlmt(c_tptp_member2076_mt,c_basekb) )).

% Cyc Assertion #2178586:
fof(ax3_5470,axiom,(
    genlmt(c_tptp_member1913_mt,c_basekb) )).

% Cyc Assertion #2176806:
fof(ax3_5471,axiom,(
    genlmt(c_tptp_member1468_mt,c_basekb) )).

% Cyc Assertion #1405146:
fof(ax3_5472,axiom,(
    arg2isa(f_linkgrammarlinkfn(s_rw),c_cycparsingtoken) )).

fof(ax3_5473,axiom,(
    ! [ARG1,ARG2] :
      ( linkgrammarlinkfnrw(ARG1,ARG2)
     => cycparsingtoken(ARG2) ) )).

% Cyc Assertion #429941:
fof(ax3_5474,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcbronlinecoukcompanyprofileaspguidd80ec5c2_6048_4b8f_b693_8a87ad230a64)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1326001:
fof(ax3_5475,axiom,
    ( mtvisible(c_keinteractionresourcetestmt)
   => isa(c_inregion,f_sampleinstanceoftypeforprogramfn(c_relativelocationalpredicate,c_cycanalyticenvironment_theprogram)) )).

fof(ax3_5476,axiom,
    ( mtvisible(c_keinteractionresourcetestmt)
   => sampleinstanceoftypeforprogramfnrelativelocationalpredicatecycanalyticenvironment_theprogram(c_inregion) )).

% Cyc Assertion #2177366:
fof(ax3_5477,axiom,(
    genlmt(c_tptp_member1608_mt,c_basekb) )).

% Cyc Assertion #2184958:
fof(ax3_5478,axiom,(
    genlmt(c_tptp_member3506_mt,c_basekb) )).

% Cyc Assertion #1111756:
fof(ax3_5479,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnowtorontocomissues1719entfilmhtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2183294:
fof(ax3_5480,axiom,(
    genlmt(c_tptp_member3090_mt,c_basekb) )).

% Cyc Assertion #907244:
fof(ax3_5481,axiom,(
    genlmt(c_ldscgeneralcollectormt,c_pathmodeldeonticreasoningmt) )).

% Cyc Assertion #751699:
fof(ax3_5482,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2178894:
fof(ax3_5483,axiom,(
    genlmt(c_tptp_member1990_mt,c_basekb) )).

% Cyc Assertion #698615:
fof(ax3_5484,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecomforumtmaspm62284mpage5)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2195138:
fof(ax3_5485,axiom,(
    ! [TERM] :
      ( executionbyfiringsquad(TERM)
     => tptp_9_389(TERM,f_relationallexistsfn(TERM,c_tptp_9_389,c_executionbyfiringsquad,c_tptpcol_15_30259)) ) )).

fof(ax3_5486,axiom,(
    relationallexists(c_tptp_9_389,c_executionbyfiringsquad,c_tptpcol_15_30259) )).

% Cyc Assertion #942673:
fof(ax3_5487,axiom,(
    computerdataartifact(f_urlreferentfn(f_urlfn(f_urlfn(s_http_wwwdiabetesmonitorcomn019htm)))) )).

% Cyc Assertion #2005155:
fof(ax3_5488,axiom,(
    genls(c_tptpcol_9_72964,c_tptpcol_8_72708) )).

fof(ax3_5489,axiom,(
    ! [OBJ] :
      ( tptpcol_9_72964(OBJ)
     => tptpcol_8_72708(OBJ) ) )).

% Cyc Assertion #2057157:
fof(ax3_5490,axiom,(
    genls(c_tptpcol_13_93766,c_tptpcol_12_93765) )).

fof(ax3_5491,axiom,(
    ! [OBJ] :
      ( tptpcol_13_93766(OBJ)
     => tptpcol_12_93765(OBJ) ) )).

% Cyc Assertion #931997:
fof(ax3_5492,axiom,(
    genls(c_vasoconstrictor,c_inanimateobject) )).

fof(ax3_5493,axiom,(
    ! [OBJ] :
      ( vasoconstrictor(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #1559053:
fof(ax3_5494,axiom,(
    genls(c_disambiguationscoringstrategyparameter,c_individual) )).

fof(ax3_5495,axiom,(
    ! [OBJ] :
      ( disambiguationscoringstrategyparameter(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #616682:
fof(ax3_5496,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwleaderucomtheologyteenwitchcrafthtml)),c_translation_8),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1592758:
fof(ax3_5497,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #894633:
fof(ax3_5498,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumsegulletorgindexphpshowtopic42218)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172150:
fof(ax3_5499,axiom,(
    genlmt(c_tptp_member304_mt,c_basekb) )).

% Cyc Assertion #306294:
fof(ax3_5500,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhiponlinecomartistmusicssmith_will)),c_translation_30),c_basekb) )).

% Cyc Assertion #1142817:
fof(ax3_5501,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnypresscom1537filmfilmcfm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #605901:
fof(ax3_5502,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_modernmilitaryweaponsmt)
        & isa(OBJ,f_groupfn(c_ballisticmissile_scudc)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_5503,axiom,
    ( mtvisible(c_modernmilitaryweaponsmt)
   => genls(f_groupfn(c_ballisticmissile_scudc),c_partiallytangible) )).

fof(ax3_5504,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_modernmilitaryweaponsmt)
        & groupfnballisticmissile_scudc(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2172994:
fof(ax3_5505,axiom,(
    genlmt(c_tptp_member515_mt,c_basekb) )).

% Cyc Assertion #937667:
fof(ax3_5506,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_itrecisupennedumyllanguagelogarchives000313html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1459579:
fof(ax3_5507,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_expositoryarticle_regime_is_trying_to_silence_internal_dissent),c_basekb) )).

% Cyc Assertion #503596:
fof(ax3_5508,axiom,(
    genlmt(c_newlatinlexicalmt,c_basekb) )).

% Cyc Assertion #1166245:
fof(ax3_5509,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfreerepubliccomfocusf_news1531919posts)),c_translation_32),c_basekb) )).

% Cyc Assertion #2068510:
fof(ax3_5510,axiom,(
    genls(c_tptpcol_2_98304,c_tptpcol_1_65536) )).

fof(ax3_5511,axiom,(
    ! [OBJ] :
      ( tptpcol_2_98304(OBJ)
     => tptpcol_1_65536(OBJ) ) )).

% Cyc Assertion #1390410:
fof(ax3_5512,axiom,(
    genlmt(f_contextofpcwfn(c_nydell_understandingarabs_culturalreference),c_basekb) )).

% Cyc Assertion #2185394:
fof(ax3_5513,axiom,(
    genlmt(c_tptp_member3615_mt,c_basekb) )).

% Cyc Assertion #1509535:
fof(ax3_5514,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomexecobidostgdetail_0375726721vglance)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2184854:
fof(ax3_5515,axiom,(
    genlmt(c_tptp_member3480_mt,c_basekb) )).

% Cyc Assertion #2172118:
fof(ax3_5516,axiom,(
    genlmt(c_tptp_member296_mt,c_basekb) )).

% Cyc Assertion #390442:
fof(ax3_5517,axiom,(
    arg2isa(c_inferencereliesonstringininfostructure,c_abstractinformationstructure) )).

fof(ax3_5518,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( inferencereliesonstringininfostructure(ARG1,ARG2,ARG3)
     => abstractinformationstructure(ARG2) ) )).

% Cyc Assertion #254403:
fof(ax3_5519,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_fisherman))
     => partiallytangible(OBJ) ) )).

fof(ax3_5520,axiom,(
    genls(f_groupfn(c_fisherman),c_partiallytangible) )).

fof(ax3_5521,axiom,(
    ! [OBJ] :
      ( groupfnfisherman(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #411321:
fof(ax3_5522,axiom,(
    genls(c_cycorppayperiod,c_individual) )).

fof(ax3_5523,axiom,(
    ! [OBJ] :
      ( cycorppayperiod(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1822754:
fof(ax3_5524,axiom,(
    genls(c_tptpcol_1_1,c_tptpcol_0_0) )).

fof(ax3_5525,axiom,(
    ! [OBJ] :
      ( tptpcol_1_1(OBJ)
     => tptpcol_0_0(OBJ) ) )).

% Cyc Assertion #1732446:
fof(ax3_5526,axiom,(
    genlmt(c_pq68mt,c_testvocabularymt) )).

% Cyc Assertion #641358:
fof(ax3_5527,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_detonateanexplosivecharge,c_actiononobject,s_33f3c325_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_5528,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_detonateanexplosivecharge,c_actiononobject,s_33f3c325_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_5529,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarydetonateanexplosivechargeactiononobject33f3c325_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #199821:
fof(ax3_5530,axiom,(
    genls(c_individualcustom,c_individual) )).

fof(ax3_5531,axiom,(
    ! [OBJ] :
      ( individualcustom(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #876920:
fof(ax3_5532,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsmoeorglistsjoniv04n231)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1118719:
fof(ax3_5533,axiom,(
    genls(c_cycinternaltask_23_2,c_individual) )).

fof(ax3_5534,axiom,(
    ! [OBJ] :
      ( cycinternaltask_23_2(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #817896:
fof(ax3_5535,axiom,(
    genls(c_dryricin,c_partiallytangible) )).

fof(ax3_5536,axiom,(
    ! [OBJ] :
      ( dryricin(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #338876:
fof(ax3_5537,axiom,(
    genlmt(c_scenariodescriptionmt,c_basekb) )).

% Cyc Assertion #793575:
fof(ax3_5538,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_12),c_basekb) )).

% Cyc Assertion #1689653:
fof(ax3_5539,axiom,(
    genlmt(c_computersecuritydatamt,c_basekb) )).

% Cyc Assertion #1645494:
fof(ax3_5540,axiom,(
    arg2isa(c_tasktypecommensuratewithoptype,c_collection) )).

fof(ax3_5541,axiom,(
    ! [ARG1,ARG2] :
      ( tasktypecommensuratewithoptype(ARG1,ARG2)
     => collection(ARG2) ) )).

% Cyc Assertion #2178142:
fof(ax3_5542,axiom,(
    genlmt(c_tptp_member1802_mt,c_basekb) )).

% Cyc Assertion #770340:
fof(ax3_5543,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_diagonallyorgforumviewtopicphpp98891sid30402306706f8b17405a36ee5f5f6846)),c_translation_2),c_basekb) )).

% Cyc Assertion #2176502:
fof(ax3_5544,axiom,(
    genlmt(c_tptp_member1392_mt,c_basekb) )).

% Cyc Assertion #2178339:
fof(ax3_5545,axiom,(
    genlmt(c_tptp_member1851_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #421951:
fof(ax3_5546,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_bombingtokillusofficials,c_actiononobject,s_33fdfc52_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_5547,axiom,(
    genls(f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_bombingtokillusofficials,c_actiononobject,s_33fdfc52_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_5548,axiom,(
    ! [OBJ] :
      ( unsatisfactoryattempttofnpropersubcollectionnamedfn_ternarybombingtokillusofficialsactiononobject33fdfc52_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #827717:
fof(ax3_5549,axiom,
    ( mtvisible(c_worldpoliticalgeographydatavocabularymt)
   => state_geopolitical(c_boke_regionguinea) )).

% Cyc Assertion #1682804:
fof(ax3_5550,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_business_as_usual_in_syria),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #1020372:
fof(ax3_5551,axiom,(
    genlmt(c_drugsinafricamt,c_basekb) )).

% Cyc Assertion #777990:
fof(ax3_5552,axiom,(
    genls(c_pfizersalesdistrict,c_individual) )).

fof(ax3_5553,axiom,(
    ! [OBJ] :
      ( pfizersalesdistrict(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #646322:
fof(ax3_5554,axiom,(
    genls(c_phosphoroustrichloride,c_partiallytangible) )).

fof(ax3_5555,axiom,(
    ! [OBJ] :
      ( phosphoroustrichloride(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2183710:
fof(ax3_5556,axiom,(
    genlmt(c_tptp_member3194_mt,c_basekb) )).

% Cyc Assertion #518559:
fof(ax3_5557,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthinkcentreorgarticlecfmarticleid2264)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #655278:
fof(ax3_5558,axiom,(
    genls(c_methyldiethoxyphosphine,c_partiallytangible) )).

fof(ax3_5559,axiom,(
    ! [OBJ] :
      ( methyldiethoxyphosphine(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1345149:
fof(ax3_5560,axiom,
    ( mtvisible(c_worldgeographymt)
   => state_geopolitical(c_mackenzie_countynewzealand) )).

% Cyc Assertion #768697:
fof(ax3_5561,axiom,(
    genls(c_majorbugzillabugreport,c_individual) )).

fof(ax3_5562,axiom,(
    ! [OBJ] :
      ( majorbugzillabugreport(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #739031:
fof(ax3_5563,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_lisnewsorgmdoneiljournal)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2181994:
fof(ax3_5564,axiom,(
    genlmt(c_tptp_member2765_mt,c_basekb) )).

% Cyc Assertion #527830:
fof(ax3_5565,axiom,(
    arg2isa(c_errorrate,c_scalarinterval) )).

fof(ax3_5566,axiom,(
    ! [ARG1,ARG2] :
      ( errorrate(ARG1,ARG2)
     => scalarinterval(ARG2) ) )).

% Cyc Assertion #1558756:
fof(ax3_5567,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmkbmemorialcominterviewsinvitedtalktrans)),c_translation_31),c_basekb) )).

% Cyc Assertion #1443734:
fof(ax3_5568,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmbugcomdb36609)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #370221:
fof(ax3_5569,axiom,
    ( mtvisible(c_usgovernmentdomesticorganizationdatamt)
   => usfederalgovernmentorganization(c_governmentprintingoffice_legalgovernmentorganization) )).

% Cyc Assertion #695591:
fof(ax3_5570,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_syrias_intelligence_services_origins_and_development),c_ldscgeneralcollectormt) )).

% Cyc Assertion #744011:
fof(ax3_5571,axiom,(
    genlmt(c_gregoriancalendarvocabularymt,c_basekb) )).

% Cyc Assertion #2172510:
fof(ax3_5572,axiom,(
    genlmt(c_tptp_member394_mt,c_basekb) )).

% Cyc Assertion #734922:
fof(ax3_5573,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_juicefn(c_fruit))
     => partiallytangible(OBJ) ) )).

fof(ax3_5574,axiom,(
    genls(f_juicefn(c_fruit),c_partiallytangible) )).

fof(ax3_5575,axiom,(
    ! [OBJ] :
      ( juicefnfruit(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2177798:
fof(ax3_5576,axiom,(
    genlmt(c_tptp_member1716_mt,c_basekb) )).

% Cyc Assertion #796991:
fof(ax3_5577,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombamcdonaldsrestaurant,c_actiononobject,s_33d84be2_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_5578,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_bombamcdonaldsrestaurant,c_actiononobject,s_33d84be2_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_5579,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternarybombamcdonaldsrestaurantactiononobject33d84be2_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2357194:
fof(ax3_5580,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_spindleheadmt)
        & furpelt(INS) )
     => tptpofobject(INS,f_tptpquantityfn_1(n_328)) ) )).

fof(ax3_5581,axiom,
    ( mtvisible(c_tptp_spindleheadmt)
   => relationallinstance(c_tptpofobject,c_furpelt,f_tptpquantityfn_1(n_328)) )).

% Cyc Assertion #2185390:
fof(ax3_5582,axiom,(
    genlmt(c_tptp_member3614_mt,c_basekb) )).

% Cyc Assertion #304424:
fof(ax3_5583,axiom,(
    genlmt(f_contextofpcwfn(c_thehobbit_novel),c_basekb) )).

% Cyc Assertion #575705:
fof(ax3_5584,axiom,(
    genls(c_giftbasket,c_partiallytangible) )).

fof(ax3_5585,axiom,(
    ! [OBJ] :
      ( giftbasket(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1193321:
fof(ax3_5586,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_forumfrankblacknettopicasptopic_id11553whichpage12)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1247421:
fof(ax3_5587,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikitalk_list_of_languages_by_number_of_native_speakers)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #187055:
fof(ax3_5588,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwangelfirecomtv2ofawgiles09html)),c_translation_33),c_basekb) )).

% Cyc Assertion #432968:
fof(ax3_5589,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtelegraphcouknewsmainjhtmlxmlnews20010919nuls19xml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #554586:
fof(ax3_5590,axiom,(
    genls(c_flippingacoin,c_individual) )).

fof(ax3_5591,axiom,(
    ! [OBJ] :
      ( flippingacoin(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #674035:
fof(ax3_5592,axiom,(
    genls(c_dusty,c_partiallytangible) )).

fof(ax3_5593,axiom,(
    ! [OBJ] :
      ( dusty(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2362447:
fof(ax3_5594,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member2487_mt)
        & isa(INS,f_subcollectionofwithrelationfromfn(c_building,c_operatesfacilities,c_europeanunion)) )
     => tptpofobject(INS,f_tptpquantityfn_5(n_19)) ) )).

fof(ax3_5595,axiom,
    ( mtvisible(c_tptp_member2487_mt)
   => relationallinstance(c_tptpofobject,f_subcollectionofwithrelationfromfn(c_building,c_operatesfacilities,c_europeanunion),f_tptpquantityfn_5(n_19)) )).

% Cyc Assertion #1480226:
fof(ax3_5596,axiom,(
    applicationcontext(c_externalontologyprojectsmt) )).

% Cyc Assertion #808089:
fof(ax3_5597,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cbinicintjun02htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2181330:
fof(ax3_5598,axiom,(
    genlmt(c_tptp_member2599_mt,c_basekb) )).

% Cyc Assertion #246382:
fof(ax3_5599,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwallmovieportalcomm1997_shine62html)),c_translation_29),c_basekb) )).

% Cyc Assertion #936959:
fof(ax3_5600,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_accessoryfn_activity(f_playingfn(c_boxing_sportcw)))
     => artifact(OBJ) ) )).

fof(ax3_5601,axiom,(
    genls(f_accessoryfn_activity(f_playingfn(c_boxing_sportcw)),c_artifact) )).

fof(ax3_5602,axiom,(
    ! [OBJ] :
      ( accessoryfn_activityplayingfnboxing_sportcw(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #298412:
fof(ax3_5603,axiom,(
    genlmt(c_worldculturalgeographydatamt,c_worldgeographydualistmt) )).

% Cyc Assertion #2172022:
fof(ax3_5604,axiom,(
    genlmt(c_tptp_member272_mt,c_basekb) )).

% Cyc Assertion #2185386:
fof(ax3_5605,axiom,(
    genlmt(c_tptp_member3613_mt,c_basekb) )).

% Cyc Assertion #1923554:
fof(ax3_5606,axiom,(
    genls(c_tptpcol_10_40324,c_tptpcol_9_40196) )).

fof(ax3_5607,axiom,(
    ! [OBJ] :
      ( tptpcol_10_40324(OBJ)
     => tptpcol_9_40196(OBJ) ) )).

% Cyc Assertion #1362381:
fof(ax3_5608,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cycledogblogspotcom200507our_fordhtml)),c_translation_2),c_basekb) )).

% Cyc Assertion #922133:
fof(ax3_5609,axiom,(
    genls(c_cursivestyleofwriting,c_collection) )).

fof(ax3_5610,axiom,(
    ! [OBJ] :
      ( cursivestyleofwriting(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #937244:
fof(ax3_5611,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbfiorguksightandsoundreviewsdetailsphpid197)),c_translation_28),c_basekb) )).

% Cyc Assertion #2183318:
fof(ax3_5612,axiom,(
    genlmt(c_tptp_member3096_mt,c_basekb) )).

% Cyc Assertion #1501302:
fof(ax3_5613,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwitvsorgoutsidelookinginfilmhtml)),c_translation_20),c_basekb) )).

% Cyc Assertion #899614:
fof(ax3_5614,axiom,(
    genls(c_pathsystemtype_structural,c_collection) )).

fof(ax3_5615,axiom,(
    ! [OBJ] :
      ( pathsystemtype_structural(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #207918:
fof(ax3_5616,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_s6invisionfreecom80s_cartoonsindexphpshowtopic2854viewgetnewpost)),c_translation_2),c_basekb) )).

% Cyc Assertion #2182354:
fof(ax3_5617,axiom,(
    genlmt(c_tptp_member2855_mt,c_basekb) )).

% Cyc Assertion #313646:
fof(ax3_5618,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwlibvirginiaedusmallexhibitsrave_reviewsbeyond_gwtwhtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #1292691:
fof(ax3_5619,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcanoecajammoviesartistsppreston_kellyhtml)),c_translation_31),c_basekb) )).

% Cyc Assertion #432009:
fof(ax3_5620,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfast_rewindcomgoingundercoverhtm)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2172886:
fof(ax3_5621,axiom,(
    genlmt(c_tptp_member488_mt,c_basekb) )).

% Cyc Assertion #825564:
fof(ax3_5622,axiom,(
    genls(c_pentaerythritol,c_partiallytangible) )).

fof(ax3_5623,axiom,(
    ! [OBJ] :
      ( pentaerythritol(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #309860:
fof(ax3_5624,axiom,(
    genls(c_systemofwrittenmaterials,c_aspatialinformationstore) )).

fof(ax3_5625,axiom,(
    ! [OBJ] :
      ( systemofwrittenmaterials(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1126267:
fof(ax3_5626,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcueduirmabout_irmself_study96_theoryhtml)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1446862:
fof(ax3_5627,axiom,(
    genls(c_twodimensionalthing,c_intangibleindividual) )).

fof(ax3_5628,axiom,(
    ! [OBJ] :
      ( twodimensionalthing(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #1095823:
fof(ax3_5629,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwthepoormannetarchives001684html)),c_translation_2),c_basekb) )).

% Cyc Assertion #932730:
fof(ax3_5630,axiom,(
    genlmt(c_machinelearningspindleheadmt,f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1998)))) )).

% Cyc Assertion #1920803:
fof(ax3_5631,axiom,(
    firstordercollection(c_tptpcol_15_39225) )).

% Cyc Assertion #2174638:
fof(ax3_5632,axiom,(
    genlmt(c_tptp_member926_mt,c_basekb) )).

% Cyc Assertion #620871:
fof(ax3_5633,axiom,(
    genls(c_militarypoliceofficer,c_militaryperson) )).

fof(ax3_5634,axiom,(
    ! [OBJ] :
      ( militarypoliceofficer(OBJ)
     => militaryperson(OBJ) ) )).

% Cyc Assertion #634368:
fof(ax3_5635,axiom,(
    genlmt(c_kentestmt,c_basekb) )).

% Cyc Assertion #1123069:
fof(ax3_5636,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncoukexecobidosasinb00004s8ie)),c_translation_33),c_basekb) )).

% Cyc Assertion #592971:
fof(ax3_5637,axiom,(
    genlmt(c_cycorpproductsmt,c_basekb) )).

% Cyc Assertion #675407:
fof(ax3_5638,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwasha_foundationorgwomenwomenhelen_gurley_brownphp)),c_translation_20),c_basekb) )).

% Cyc Assertion #2172750:
fof(ax3_5639,axiom,(
    genlmt(c_tptp_member454_mt,c_basekb) )).

% Cyc Assertion #556476:
fof(ax3_5640,axiom,(
    genlmt(c_trec_mt,c_cycorpproductsmt) )).

% Cyc Assertion #830832:
fof(ax3_5641,axiom,
    ( mtvisible(c_cychistoricalpossibilitytheorymt)
   => genls(c_vaccineforhumans,c_partiallytangible) )).

fof(ax3_5642,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_cychistoricalpossibilitytheorymt)
        & vaccineforhumans(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1722515:
fof(ax3_5643,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_minute_by_minute_account),c_ldscgeneralcollectormt) )).

% Cyc Assertion #1558576:
fof(ax3_5644,axiom,(
    genlmt(c_fixedstructurevocabularymt,c_basekb) )).

% Cyc Assertion #355146:
fof(ax3_5645,axiom,(
    individual(f_urlfn(f_urlfn(s_http_usersrowanedububrow63movie_favshtm))) )).

% Cyc Assertion #2001957:
fof(ax3_5646,axiom,(
    genls(c_tptpcol_7_71684,c_tptpcol_6_71683) )).

fof(ax3_5647,axiom,(
    ! [OBJ] :
      ( tptpcol_7_71684(OBJ)
     => tptpcol_6_71683(OBJ) ) )).

% Cyc Assertion #748567:
fof(ax3_5648,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommmbhtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #1069156:
fof(ax3_5649,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbrainglecomcommunitywikiphpusergizzerpagejuly)),c_translation_23),c_basekb) )).

% Cyc Assertion #2172526:
fof(ax3_5650,axiom,(
    genlmt(c_tptp_member398_mt,c_basekb) )).

% Cyc Assertion #2171342:
fof(ax3_5651,axiom,(
    genlmt(c_tptp_member102_mt,c_basekb) )).

% Cyc Assertion #1272960:
fof(ax3_5652,axiom,(
    genls(c_nlterm,c_thing) )).

fof(ax3_5653,axiom,(
    ! [OBJ] :
      ( nlterm(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1230049:
fof(ax3_5654,axiom,(
    genlmt(c_humanbodystructuremt,c_basekb) )).

% Cyc Assertion #1641761:
fof(ax3_5655,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoutsource2indiacomtrendseurope_outsourcingasp)),c_translation_33),c_basekb) )).

% Cyc Assertion #1557708:
fof(ax3_5656,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_freepagesgenealogyrootswebcomehowetimeline1820html)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #494733:
fof(ax3_5657,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1668072:
fof(ax3_5658,axiom,(
    individual(f_urlfn(f_urlfn(s_http_wwwahwatukeecomafnentertainmentarticles030423ahtml))) )).

% Cyc Assertion #1063513:
fof(ax3_5659,axiom,(
    genlmt(c_reportcontent_dla_j6_13011,c_basekb) )).

% Cyc Assertion #1697742:
fof(ax3_5660,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_egyptianpyramid))
     => partiallytangible(OBJ) ) )).

fof(ax3_5661,axiom,(
    genls(f_groupfn(c_egyptianpyramid),c_partiallytangible) )).

fof(ax3_5662,axiom,(
    ! [OBJ] :
      ( groupfnegyptianpyramid(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #912678:
fof(ax3_5663,axiom,(
    genlmt(c_worldcompletegeographymt,c_worldgeographymt) )).

% Cyc Assertion #554357:
fof(ax3_5664,axiom,(
    genls(c_acrolein,c_partiallytangible) )).

fof(ax3_5665,axiom,(
    ! [OBJ] :
      ( acrolein(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1117563:
fof(ax3_5666,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_0),c_basekb) )).

% Cyc Assertion #2184266:
fof(ax3_5667,axiom,(
    genlmt(c_tptp_member3333_mt,c_basekb) )).

% Cyc Assertion #1408920:
fof(ax3_5668,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_denverbizjournalscomtriadstories20040105daily32html)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1709488:
fof(ax3_5669,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_calclabmathtamueduc_rincon_mateusproject11html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2186422:
fof(ax3_5670,axiom,(
    genlmt(c_tptp_member3872_mt,c_basekb) )).

% Cyc Assertion #622569:
fof(ax3_5671,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive20040915n61crtr29jarhtm)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #631842:
fof(ax3_5672,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtehtm)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #435040:
fof(ax3_5673,axiom,(
    genlmt(c_firemanclimbingladderimt,c_basekb) )).

% Cyc Assertion #857095:
fof(ax3_5674,axiom,(
    genlmt(c_myseparsingmt_daves,c_basekb) )).

% Cyc Assertion #1489180:
fof(ax3_5675,axiom,(
    genls(c_munsellhue,c_collection) )).

fof(ax3_5676,axiom,(
    ! [OBJ] :
      ( munsellhue(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #529357:
fof(ax3_5677,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwspiritofhopemcckcorgfellowshipnominee20announced20for20next20mcc20moderatorhtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #314361:
fof(ax3_5678,axiom,(
    genls(c_ideologicalactivity,c_individual) )).

fof(ax3_5679,axiom,(
    ! [OBJ] :
      ( ideologicalactivity(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #715918:
fof(ax3_5680,axiom,(
    genlmt(c_dungeonsanddragonsmt,c_basekb) )).

% Cyc Assertion #320647:
fof(ax3_5681,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomscrewball20comedy20film)),c_translation_33),c_basekb) )).

% Cyc Assertion #1243780:
fof(ax3_5682,axiom,(
    genlmt(c_missileindexmt,c_hpkbvocabmt) )).

% Cyc Assertion #917541:
fof(ax3_5683,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmegaessayscomviewpaper83347html)),c_translation_29),c_basekb) )).

% Cyc Assertion #1389019:
fof(ax3_5684,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_whos_who_in_syrias_leadership),c_basekb) )).

% Cyc Assertion #1180605:
fof(ax3_5685,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilmbugcomdb36609)),c_translation_31),c_basekb) )).

% Cyc Assertion #998139:
fof(ax3_5686,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvd_movie_shoporgdvd0b00005uo7fsome_folks_call_it_a_sling_bladehtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2170950:
fof(ax3_5687,axiom,(
    genlmt(c_tptp_member4_mt,c_basekb) )).

% Cyc Assertion #1561060:
fof(ax3_5688,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_shoal))
     => individual(OBJ) ) )).

fof(ax3_5689,axiom,(
    genls(f_groupfn(c_shoal),c_individual) )).

fof(ax3_5690,axiom,(
    ! [OBJ] :
      ( groupfnshoal(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #742834:
fof(ax3_5691,axiom,(
    genls(c_cycinternaltask_researchcyc_project_the_55,c_individual) )).

fof(ax3_5692,axiom,(
    ! [OBJ] :
      ( cycinternaltask_researchcyc_project_the_55(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2172010:
fof(ax3_5693,axiom,(
    genlmt(c_tptp_member269_mt,c_basekb) )).

% Cyc Assertion #2359761:
fof(ax3_5694,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member3214_mt)
        & supplementaryterrainfeature(INS) )
     => tptpofobject(INS,f_tptpquantityfn_11(n_909)) ) )).

fof(ax3_5695,axiom,
    ( mtvisible(c_tptp_member3214_mt)
   => relationallinstance(c_tptpofobject,c_supplementaryterrainfeature,f_tptpquantityfn_11(n_909)) )).

% Cyc Assertion #1108362:
fof(ax3_5696,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordnicolascageoffset0)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #443597:
fof(ax3_5697,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_a_second_critic_of_syria_is_assassinated_in_lebanon),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #1650755:
fof(ax3_5698,axiom,(
    genlmt(c_basekb,c_universalvocabularymt) )).

% Cyc Assertion #1243059:
fof(ax3_5699,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_executioner))
     => partiallytangible(OBJ) ) )).

fof(ax3_5700,axiom,(
    genls(f_groupfn(c_executioner),c_partiallytangible) )).

fof(ax3_5701,axiom,(
    ! [OBJ] :
      ( groupfnexecutioner(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1280128:
fof(ax3_5702,axiom,(
    genls(c_concessionarea,c_geographicalregion) )).

fof(ax3_5703,axiom,(
    ! [OBJ] :
      ( concessionarea(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #893659:
fof(ax3_5704,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_idfpostions,c_partiallytangible,s_3416b473_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_5705,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_idfpostions,c_partiallytangible,s_3416b473_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_5706,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryidfpostionspartiallytangible3416b473_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2182138:
fof(ax3_5707,axiom,(
    genlmt(c_tptp_member2801_mt,c_basekb) )).

% Cyc Assertion #1604616:
fof(ax3_5708,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdailyillinicomnews20041214featuresconservatismontheriseinyoungvoters_828816shtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #242804:
fof(ax3_5709,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwflabarorgdivcomjnjnnews01nsf0609d906950d45fcb85256da90069979fopendocumentexpandsection12c20)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1139610:
fof(ax3_5710,axiom,(
    genls(c_methylphosphonicdichloride,c_partiallytangible) )).

fof(ax3_5711,axiom,(
    ! [OBJ] :
      ( methylphosphonicdichloride(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2375063:
fof(ax3_5712,axiom,
    ( mtvisible(c_cyclistsmt)
   => runningshorts(c_tptprunningshorts) )).

% Cyc Assertion #1377690:
fof(ax3_5713,axiom,(
    genls(c_defaultoninternationalloan,c_individual) )).

fof(ax3_5714,axiom,(
    ! [OBJ] :
      ( defaultoninternationalloan(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1391211:
fof(ax3_5715,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovienavigatororgdigitalragehtm)),c_translation_1),c_basekb) )).

% Cyc Assertion #1143573:
fof(ax3_5716,axiom,(
    genls(c_telephonepole,c_partiallytangible) )).

fof(ax3_5717,axiom,(
    ! [OBJ] :
      ( telephonepole(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1579836:
fof(ax3_5718,axiom,(
    genlmt(c_bravocriterion3_infoconcriterionmt,c_basekb) )).

% Cyc Assertion #1061940:
fof(ax3_5719,axiom,
    ( mtvisible(c_usgovernmentorganizationdatamt)
   => usfederalgovernmentagency(c_usgeologicalsurvey) )).

% Cyc Assertion #1238258:
fof(ax3_5720,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoneplacecomministriesinsight_for_livingarticleasparticle_id228)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #574471:
fof(ax3_5721,axiom,(
    genlmt(c_cyclistsmt,c_cycorpagentsmt) )).

% Cyc Assertion #550646:
fof(ax3_5722,axiom,(
    genls(c_contrail,c_inanimateobject_nonnatural) )).

fof(ax3_5723,axiom,(
    ! [OBJ] :
      ( contrail(OBJ)
     => inanimateobject_nonnatural(OBJ) ) )).

% Cyc Assertion #1737572:
fof(ax3_5724,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhersheylibraryorgprogramsenrichmentclasseshtm)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1337213:
fof(ax3_5725,axiom,(
    applicationcontext(c_uia_weather_demoenvironmentmt) )).

% Cyc Assertion #638966:
fof(ax3_5726,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwriternetcoukphp2newsphpid327item212)),c_translation_22),c_basekb) )).

% Cyc Assertion #1923815:
fof(ax3_5727,axiom,(
    genls(c_tptpcol_15_40430,c_tptpcol_14_40429) )).

fof(ax3_5728,axiom,(
    ! [OBJ] :
      ( tptpcol_15_40430(OBJ)
     => tptpcol_14_40429(OBJ) ) )).

% Cyc Assertion #2176858:
fof(ax3_5729,axiom,(
    genlmt(c_tptp_member1481_mt,c_basekb) )).

% Cyc Assertion #683007:
fof(ax3_5730,axiom,(
    genls(c_cycinternaltask_researchcyc_project_the_52,c_individual) )).

fof(ax3_5731,axiom,(
    ! [OBJ] :
      ( cycinternaltask_researchcyc_project_the_52(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1182305:
fof(ax3_5732,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc33477)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1657934:
fof(ax3_5733,axiom,(
    genlmt(c_grandmaandbabyimt,c_basekb) )).

% Cyc Assertion #1303421:
fof(ax3_5734,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdsaocorgnewslettersjan05pdf)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #483748:
fof(ax3_5735,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfilm_makerscoopcomcatalogchtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1353498:
fof(ax3_5736,axiom,(
    genlmt(c_computerhardwaremt,c_basekb) )).

% Cyc Assertion #1561437:
fof(ax3_5737,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cgiebaycomwarning_world_demanding_god_inspired_story_manuscript_w0qqitemz7377202690qqcategoryz2196qqcmdzviewitem)),c_translation_30),c_basekb) )).

% Cyc Assertion #869354:
fof(ax3_5738,axiom,(
    genls(c_cycsubjectclumpimagefile,c_individual) )).

fof(ax3_5739,axiom,(
    ! [OBJ] :
      ( cycsubjectclumpimagefile(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1129675:
fof(ax3_5740,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_shakespeareauthorshipcomox12html)),c_translation_2),c_basekb) )).

% Cyc Assertion #2118032:
fof(ax3_5741,axiom,(
    genls(c_tptpcol_12_118116,c_tptpcol_11_118084) )).

fof(ax3_5742,axiom,(
    ! [OBJ] :
      ( tptpcol_12_118116(OBJ)
     => tptpcol_11_118084(OBJ) ) )).

% Cyc Assertion #1710079:
fof(ax3_5743,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsoftimagecomcommunityxsimagcsvolume_3issue_71htm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1398465:
fof(ax3_5744,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewagebdcom2005mar19lithtml)),c_translation_21),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1214479:
fof(ax3_5745,axiom,(
    genlmt(c_parsetreerepresentationvocabularymt_deprecated,c_basekb) )).

% Cyc Assertion #352531:
fof(ax3_5746,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwwikitravelorgentallahassee)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #626492:
fof(ax3_5747,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamericasdvdstorecomb00005uo7fsome_folks_call_it_a_sling_bladeshtml)),c_translation_32),c_basekb) )).

% Cyc Assertion #1515864:
fof(ax3_5748,axiom,(
    genlmt(c_programmodelmt,c_basekb) )).

% Cyc Assertion #453479:
fof(ax3_5749,axiom,(
    genlmt(c_ethnicgroupsmt,c_basekb) )).

% Cyc Assertion #159189:
fof(ax3_5750,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_blogfastcompanycomarchives20050125depression_sellshtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #630003:
fof(ax3_5751,axiom,(
    genls(c_computerdesktoptheme,c_individual) )).

fof(ax3_5752,axiom,(
    ! [OBJ] :
      ( computerdesktoptheme(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1299020:
fof(ax3_5753,axiom,(
    genlmt(c_ndu_iranasamilitarythreatmt,c_hpkbvocabmt) )).

% Cyc Assertion #621389:
fof(ax3_5754,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(c_akbuser,c_genericintelligenceanalysis_cae_allotment,c_cycanalyticenvironment_theprogram),c_basekb) )).

% Cyc Assertion #2182770:
fof(ax3_5755,axiom,(
    genlmt(c_tptp_member2959_mt,c_basekb) )).

% Cyc Assertion #1448449:
fof(ax3_5756,axiom,(
    microtheory(c_themotleyfoolukcorpusmt) )).

% Cyc Assertion #2178918:
fof(ax3_5757,axiom,(
    genlmt(c_tptp_member1996_mt,c_basekb) )).

% Cyc Assertion #1556228:
fof(ax3_5758,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_14),c_basekb) )).

% Cyc Assertion #1084697:
fof(ax3_5759,axiom,(
    genls(c_retreat_place,c_partiallytangible) )).

fof(ax3_5760,axiom,(
    ! [OBJ] :
      ( retreat_place(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2174694:
fof(ax3_5761,axiom,(
    genlmt(c_tptp_member940_mt,c_basekb) )).

% Cyc Assertion #1165564:
fof(ax3_5762,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_vh1shopvh1comnamepageaspxpidp66596typevloc33697)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #908176:
fof(ax3_5763,axiom,(
    genls(c_threateningtodostabbingsomethingobjectactedonperson,c_individual) )).

fof(ax3_5764,axiom,(
    ! [OBJ] :
      ( threateningtodostabbingsomethingobjectactedonperson(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #569181:
fof(ax3_5765,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsciencedailycomencyclopediatechnical_university_of_munich)),c_translation_0),c_basekb) )).

% Cyc Assertion #2185482:
fof(ax3_5766,axiom,(
    genlmt(c_tptp_member3637_mt,c_basekb) )).

% Cyc Assertion #915967:
fof(ax3_5767,axiom,(
    genlmt(f_taskmodelmtfn(c_allotment_8),c_basekb) )).

% Cyc Assertion #790860:
fof(ax3_5768,axiom,(
    genlmt(c_cychistoricalpossibilitytheorymt,c_universalvocabularymt) )).

% Cyc Assertion #1381043:
fof(ax3_5769,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetmoderatethunderstormareafoggyareamistyarea(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #799509:
fof(ax3_5770,axiom,(
    genlmt(c_americancollegesportspeopledatamt,c_basekb) )).

% Cyc Assertion #506333:
fof(ax3_5771,axiom,(
    genls(c_linguisticobject,c_aspatialinformationstore) )).

fof(ax3_5772,axiom,(
    ! [OBJ] :
      ( linguisticobject(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #623675:
fof(ax3_5773,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfast_rewindcomgoingundercoverhtm)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1394615:
fof(ax3_5774,axiom,(
    genlmt(c_temporarylexicalassertionsmt,c_basekb) )).

% Cyc Assertion #770601:
fof(ax3_5775,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwtheologyeduntintrogalhtm)),c_translation_32),c_basekb) )).

% Cyc Assertion #397717:
fof(ax3_5776,axiom,(
    genls(c_securitypractice_informationsysvulnerabilityscan,c_individual) )).

fof(ax3_5777,axiom,(
    ! [OBJ] :
      ( securitypractice_informationsysvulnerabilityscan(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1755597:
fof(ax3_5778,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomhis20girl20friday)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1523741:
fof(ax3_5779,axiom,(
    genlmt(f_contentmtfn(c_yahoomoviesguide_ks),c_massmediadatamt) )).

% Cyc Assertion #691761:
fof(ax3_5780,axiom,(
    genlmt(c_organizationdatamt,c_medicalorganizationdatamt) )).

% Cyc Assertion #1170372:
fof(ax3_5781,axiom,(
    genlmt(c_nooescapearchitecturemt,c_wikiunitedkingdomgeopoliticalmt) )).

% Cyc Assertion #2185434:
fof(ax3_5782,axiom,(
    genlmt(c_tptp_member3625_mt,c_basekb) )).

% Cyc Assertion #217255:
fof(ax3_5783,axiom,(
    genlmt(f_contentmtfn(c_fg1_pc_hl_id_ks),c_basekb) )).

% Cyc Assertion #832325:
fof(ax3_5784,axiom,(
    genlmt(c_myseanonusergenerationmt22610893,c_basekb) )).

% Cyc Assertion #1589870:
fof(ax3_5785,axiom,(
    genls(c_presentingqamoduleresultstoamysentientanswersuser,c_individual) )).

fof(ax3_5786,axiom,(
    ! [OBJ] :
      ( presentingqamoduleresultstoamysentientanswersuser(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1231908:
fof(ax3_5787,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnowtorontocomissues1719entfilmhtml)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #437195:
fof(ax3_5788,axiom,(
    genls(c_instantfoodmix,c_individual) )).

fof(ax3_5789,axiom,(
    ! [OBJ] :
      ( instantfoodmix(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #437290:
fof(ax3_5790,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeocitiescomjames_cutter001rmhtm)),c_translation_24),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1764063:
fof(ax3_5791,axiom,(
    genlmt(c_pq7mt,c_testvocabularymt) )).

% Cyc Assertion #554652:
fof(ax3_5792,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulfn(f_planningfn(c_poisoning)))
     => individual(OBJ) ) )).

fof(ax3_5793,axiom,(
    genls(f_unsuccessfulfn(f_planningfn(c_poisoning)),c_individual) )).

fof(ax3_5794,axiom,(
    ! [OBJ] :
      ( unsuccessfulfnplanningfnpoisoning(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2175442:
fof(ax3_5795,axiom,(
    genlmt(c_tptp_member1127_mt,c_basekb) )).

% Cyc Assertion #1174005:
fof(ax3_5796,axiom,(
    genlmt(c_socreport_si_20030427_reportcontent,c_basekb) )).

% Cyc Assertion #1013759:
fof(ax3_5797,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvolumenycorgarticle_detailindexaspid151sectionwork)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1653947:
fof(ax3_5798,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwplaybillcomnewsarticle90099html)),c_translation_31),c_basekb) )).

% Cyc Assertion #166054:
fof(ax3_5799,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_chemicalsubstancefn(c_ferricyanideion))
     => partiallytangible(OBJ) ) )).

fof(ax3_5800,axiom,(
    genls(f_chemicalsubstancefn(c_ferricyanideion),c_partiallytangible) )).

fof(ax3_5801,axiom,(
    ! [OBJ] :
      ( chemicalsubstancefnferricyanideion(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #748652:
fof(ax3_5802,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_tastefn(c_coffee_beverage))
     => partiallytangible(OBJ) ) )).

fof(ax3_5803,axiom,(
    genls(f_tastefn(c_coffee_beverage),c_partiallytangible) )).

fof(ax3_5804,axiom,(
    ! [OBJ] :
      ( tastefncoffee_beverage(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #895835:
fof(ax3_5805,axiom,(
    arg2isa(c_normalworkhours,c_cyclicalintervaltypeoncalendarscale) )).

fof(ax3_5806,axiom,(
    ! [ARG1,ARG2] :
      ( normalworkhours(ARG1,ARG2)
     => cyclicalintervaltypeoncalendarscale(ARG2) ) )).

% Cyc Assertion #327518:
fof(ax3_5807,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_timblairspleenvillecomarchives007948php)),c_translation_0),c_basekb) )).

% Cyc Assertion #2172730:
fof(ax3_5808,axiom,(
    genlmt(c_tptp_member449_mt,c_basekb) )).

% Cyc Assertion #2172978:
fof(ax3_5809,axiom,(
    genlmt(c_tptp_member511_mt,c_basekb) )).

% Cyc Assertion #545815:
fof(ax3_5810,axiom,(
    genls(c_creditworthiness,c_collection) )).

fof(ax3_5811,axiom,(
    ! [OBJ] :
      ( creditworthiness(OBJ)
     => collection(OBJ) ) )).

% Cyc Assertion #842220:
fof(ax3_5812,axiom,(
    genls(c_partygift,c_artifact) )).

fof(ax3_5813,axiom,(
    ! [OBJ] :
      ( partygift(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1317685:
fof(ax3_5814,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhawaiifilmofficecompdfhollywood_tropicalpdf)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #454633:
fof(ax3_5815,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwentropiaforumcomforumshistorytopic2216_1html)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2179954:
fof(ax3_5816,axiom,(
    genlmt(c_tptp_member2255_mt,c_basekb) )).

% Cyc Assertion #836873:
fof(ax3_5817,axiom,(
    genls(c_cruisemissile_penguinmk3,c_individual) )).

fof(ax3_5818,axiom,(
    ! [OBJ] :
      ( cruisemissile_penguinmk3(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2364402:
fof(ax3_5819,axiom,(
    ! [INS] :
      ( ( mtvisible(c_tptp_member2249_mt)
        & coveredbridge(INS) )
     => tptpofobject(INS,f_tptpquantityfn_20(n_464)) ) )).

fof(ax3_5820,axiom,
    ( mtvisible(c_tptp_member2249_mt)
   => relationallinstance(c_tptpofobject,c_coveredbridge,f_tptpquantityfn_20(n_464)) )).

% Cyc Assertion #2477320:
fof(ax3_5821,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x4_y1) )).

% Cyc Assertion #2171670:
fof(ax3_5822,axiom,(
    genlmt(c_tptp_member184_mt,c_basekb) )).

% Cyc Assertion #1754664:
fof(ax3_5823,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwempireonlinecoukforumtmaspm62284mpage5)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #707574:
fof(ax3_5824,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_cheerleaderyozcomarchives001947html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2176870:
fof(ax3_5825,axiom,(
    genlmt(c_tptp_member1484_mt,c_basekb) )).

% Cyc Assertion #946103:
fof(ax3_5826,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3o2rckamse9x7_encodingutf8displaypublicpage19)),c_translation_31),c_basekb) )).

% Cyc Assertion #1711507:
fof(ax3_5827,axiom,(
    genlmt(c_aisdatamt,c_basekb) )).

% Cyc Assertion #489881:
fof(ax3_5828,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetmoderatebreezearealightsnowarea(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1204282:
fof(ax3_5829,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_attitudethemercurynewscomaucheese_batmanbalehtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #562429:
fof(ax3_5830,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_makinganagreement,c_with_underspecifiedagent,c_intelligentagent))
     => thing(OBJ) ) )).

fof(ax3_5831,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_makinganagreement,c_with_underspecifiedagent,c_intelligentagent),c_thing) )).

fof(ax3_5832,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnmakinganagreementwith_underspecifiedagentintelligentagent(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #1126389:
fof(ax3_5833,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwvaldostaedujmmarshkidshtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #298849:
fof(ax3_5834,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_us_state_department_web_page),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #2171606:
fof(ax3_5835,axiom,(
    genlmt(c_tptp_member168_mt,c_basekb) )).

% Cyc Assertion #996565:
fof(ax3_5836,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www123helpmecomviewaspid7874)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1491547:
fof(ax3_5837,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertlahroffset0)),c_translation_31),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1205966:
fof(ax3_5838,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_abcnetaunewenglandmornings)),c_translation_2_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #950012:
fof(ax3_5839,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvd_movie_shoporgdvd0b00005uo7fsome_folks_call_it_a_sling_bladehtml)),c_translation_33),c_basekb) )).

% Cyc Assertion #606322:
fof(ax3_5840,axiom,(
    genlmt(f_contextofpcwfn(f_etiquetteofculturefn(f_nationalculturefn(c_morocco))),c_basekb) )).

% Cyc Assertion #423937:
fof(ax3_5841,axiom,(
    genlmt(c_internationalenergyannual1996mt,c_hpkbvocabmt) )).

% Cyc Assertion #1173689:
fof(ax3_5842,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcog7orgbaimagesbajune05_engpdf)),c_translation_33),c_basekb) )).

% Cyc Assertion #1339929:
fof(ax3_5843,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainment851330stm)),c_translation_7),c_basekb) )).

% Cyc Assertion #803377:
fof(ax3_5844,axiom,(
    genlmt(c_wamt_modevalinitial_p8,c_basekb) )).

% Cyc Assertion #854481:
fof(ax3_5845,axiom,(
    genls(c_shiny,c_partiallytangible) )).

fof(ax3_5846,axiom,(
    ! [OBJ] :
      ( shiny(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1344507:
fof(ax3_5847,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcanoecajammoviesartistsppreston_kellyhtml)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1205909:
fof(ax3_5848,axiom,(
    arg2isa(c_exactlylocatedat_surfacegeographical,c_geographicalspaceregion) )).

fof(ax3_5849,axiom,(
    ! [ARG1,ARG2] :
      ( exactlylocatedat_surfacegeographical(ARG1,ARG2)
     => geographicalspaceregion(ARG2) ) )).

% Cyc Assertion #1245717:
fof(ax3_5850,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_archivestcmieirishexaminer20000826currentfpage_7htm)),c_translation_29),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1633270:
fof(ax3_5851,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_triadbizjournalscomtriadstories20040105daily32htmljstb_ln_hl)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #499710:
fof(ax3_5852,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgiabgovtnzdefaultaspchannelmemberspagemembers)),c_translation_0),c_basekb) )).

% Cyc Assertion #2185286:
fof(ax3_5853,axiom,(
    genlmt(c_tptp_member3588_mt,c_basekb) )).

% Cyc Assertion #682044:
fof(ax3_5854,axiom,(
    genlmt(c_reasoningwithconditionalmt,c_basekb) )).

% Cyc Assertion #1540963:
fof(ax3_5855,axiom,(
    genlmt(c_wordnet2_0mappingmt,c_basekb) )).

% Cyc Assertion #2477830:
fof(ax3_5856,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x22_y25) )).

% Cyc Assertion #1694085:
fof(ax3_5857,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamazoncomgpcdpmember_reviewsa3u4ft0h0nthby_encodingutf8)),c_translation_25),c_machinelearningspindleheadmt) )).

% Cyc Assertion #226676:
fof(ax3_5858,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtotypefn(c_wallofaconstruction,c_mainconstituent,f_solidfn(c_glass)))
     => partiallytangible(OBJ) ) )).

fof(ax3_5859,axiom,(
    genls(f_subcollectionofwithrelationtotypefn(c_wallofaconstruction,c_mainconstituent,f_solidfn(c_glass)),c_partiallytangible) )).

fof(ax3_5860,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtotypefnwallofaconstructionmainconstituentsolidfnglass(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1760230:
fof(ax3_5861,axiom,(
    genls(c_agent_underspecified,c_location_underspecified) )).

fof(ax3_5862,axiom,(
    ! [OBJ] :
      ( agent_underspecified(OBJ)
     => location_underspecified(OBJ) ) )).

% Cyc Assertion #1236037:
fof(ax3_5863,axiom,(
    genlmt(c_tclscriptinglanguagemt,c_basekb) )).

% Cyc Assertion #630419:
fof(ax3_5864,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webnjiteducjohnsontreebiochhtm)),c_translation_31),c_basekb) )).

% Cyc Assertion #680364:
fof(ax3_5865,axiom,(
    genls(c_householdfurnishingsmc,c_artifact) )).

fof(ax3_5866,axiom,(
    ! [OBJ] :
      ( householdfurnishingsmc(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1014669:
fof(ax3_5867,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwneverarycomn1n1umbrellahtm)),c_translation_6),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1539956:
fof(ax3_5868,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnzfilmconzdownloadsnz20film20issue2073pdf)),c_translation_33),c_basekb) )).

% Cyc Assertion #968375:
fof(ax3_5869,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_encyclopediathefreedictionarycomhowardhawks)),c_translation_26),c_basekb) )).

% Cyc Assertion #586147:
fof(ax3_5870,axiom,(
    genlmt(c_usmarinecorpspracticesmt,c_basekb) )).

% Cyc Assertion #780534:
fof(ax3_5871,axiom,
    ( mtvisible(c_worldgeographymt)
   => state_geopolitical(c_kempsbay_districtbahamas) )).

% Cyc Assertion #1461527:
fof(ax3_5872,axiom,(
    arg2isa(c_ailmentacquiredby,c_collection) )).

fof(ax3_5873,axiom,(
    ! [ARG1,ARG2,ARG3] :
      ( ailmentacquiredby(ARG1,ARG2,ARG3)
     => collection(ARG2) ) )).

% Cyc Assertion #2176918:
fof(ax3_5874,axiom,(
    genlmt(c_tptp_member1496_mt,c_basekb) )).

% Cyc Assertion #2174922:
fof(ax3_5875,axiom,(
    genlmt(c_tptp_member997_mt,c_basekb) )).

% Cyc Assertion #1344441:
fof(ax3_5876,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_israelitruck,c_partiallytangible,s_34077230_f4ed_11d9_9bea_0002b3a85b0b))
     => partiallytangible(OBJ) ) )).

fof(ax3_5877,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_israelitruck,c_partiallytangible,s_34077230_f4ed_11d9_9bea_0002b3a85b0b),c_partiallytangible) )).

fof(ax3_5878,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternaryisraelitruckpartiallytangible34077230_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #446038:
fof(ax3_5879,axiom,(
    genlmt(c_knowledgefragmentz3mt,c_basekb) )).

% Cyc Assertion #361874:
fof(ax3_5880,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwimdbcomrgtitle_teasetriviatitlett0356910trivia)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #258018:
fof(ax3_5881,axiom,(
    genlmt(c_universalvocabularymt,c_cycagencytheorymt) )).

% Cyc Assertion #1349387:
fof(ax3_5882,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmegaessayscomviewpaper83347html)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #438612:
fof(ax3_5883,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwdvdplayerreviewsnetitemsb0000cbl7a)),c_translation_28),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2177966:
fof(ax3_5884,axiom,(
    genlmt(c_tptp_member1758_mt,c_basekb) )).

% Cyc Assertion #977421:
fof(ax3_5885,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwrhdservicescomrhd20serviceshtm)),c_translation_3),c_basekb) )).

% Cyc Assertion #2182646:
fof(ax3_5886,axiom,(
    genlmt(c_tptp_member2928_mt,c_basekb) )).

% Cyc Assertion #1007502:
fof(ax3_5887,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newmanbaruchcunyedudigital2002realestatebrooklyn_daybrooklyn_day_3_pt2htm)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #665267:
fof(ax3_5888,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_attackcorseeuropeennedentrepriseinbastia,c_actiononobject,s_3402de50_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_5889,axiom,(
    genls(f_unsuccessfulattempttofn(f_propersubcollectionnamedfn_ternary(s_attackcorseeuropeennedentrepriseinbastia,c_actiononobject,s_3402de50_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_5890,axiom,(
    ! [OBJ] :
      ( unsuccessfulattempttofnpropersubcollectionnamedfn_ternaryattackcorseeuropeennedentrepriseinbastiaactiononobject3402de50_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #568284:
fof(ax3_5891,axiom,(
    genlmt(c_networksecuritytemplatemt,c_basekb) )).

% Cyc Assertion #1277873:
fof(ax3_5892,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeorgiamonthlycomfestivaloftreeshtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1495067:
fof(ax3_5893,axiom,(
    transitivebinarypredicate(c_outof_underspecifiedcontainer) )).

% Cyc Assertion #1610117:
fof(ax3_5894,axiom,(
    genlmt(c_ciaworldfactbook1996mt,c_gregoriancalendarmt) )).

% Cyc Assertion #2173914:
fof(ax3_5895,axiom,(
    genlmt(c_tptp_member745_mt,c_basekb) )).

% Cyc Assertion #2156167:
fof(ax3_5896,axiom,(
    genlpreds(c_tptptypes_7_819,c_tptptypes_6_818) )).

fof(ax3_5897,axiom,(
    ! [ARG1,ARG2] :
      ( tptptypes_7_819(ARG1,ARG2)
     => tptptypes_6_818(ARG1,ARG2) ) )).

% Cyc Assertion #2173178:
fof(ax3_5898,axiom,(
    genlmt(c_tptp_member561_mt,c_basekb) )).

% Cyc Assertion #1727123:
fof(ax3_5899,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwhughstoncomhhaa_14_1_5htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1614830:
fof(ax3_5900,axiom,(
    arg2isa(c_subcollectionofusedforfn,c_individual) )).

% Cyc Assertion #1678196:
fof(ax3_5901,axiom,(
    genlmt(c_peloponnesianwarmt,c_worldgeographydualistmt) )).

% Cyc Assertion #1606075:
fof(ax3_5902,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webamnestyorglibraryindexengasa160121999openofeng_370)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #2175630:
fof(ax3_5903,axiom,(
    genlmt(c_tptp_member1174_mt,c_basekb) )).

% Cyc Assertion #2172074:
fof(ax3_5904,axiom,(
    genlmt(c_tptp_member285_mt,c_basekb) )).

% Cyc Assertion #1300649:
fof(ax3_5905,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikihis_girl_friday)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1655533:
fof(ax3_5906,axiom,(
    genls(c_cycinternaltask_592,c_individual) )).

fof(ax3_5907,axiom,(
    ! [OBJ] :
      ( cycinternaltask_592(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2174388:
fof(ax3_5908,axiom,(
    genlmt(c_tptp_spindlecollectormt,c_tptp_member863_mt) )).

% Cyc Assertion #2165345:
fof(ax3_5909,axiom,(
    arg2isa(c_tptp_7_726,c_tptpcol_5_4100) )).

fof(ax3_5910,axiom,(
    ! [ARG1,ARG2] :
      ( tptp_7_726(ARG1,ARG2)
     => tptpcol_5_4100(ARG2) ) )).

% Cyc Assertion #2171630:
fof(ax3_5911,axiom,(
    genlmt(c_tptp_member174_mt,c_basekb) )).

% Cyc Assertion #1069004:
fof(ax3_5912,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_historical_debatesoireachtasies0071s0071197112090007html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1299301:
fof(ax3_5913,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_enwikipediaorgwikiwilliam_asher)),c_translation_2),c_basekb) )).

% Cyc Assertion #882491:
fof(ax3_5914,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_visionsofparadiseblogspotcom200508on_writinghtml)),c_translation_1),c_basekb) )).

% Cyc Assertion #542109:
fof(ax3_5915,axiom,
    ( mtvisible(c_ciaworldfactbook1995mt)
   => genls(c_manganese,c_partiallytangible) )).

fof(ax3_5916,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_ciaworldfactbook1995mt)
        & manganese(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2193876:
fof(ax3_5917,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_tptp_member2788_mt)
        & executionbyfiringsquad(TERM) )
     => tptp_9_597(TERM,f_relationallexistsfn(TERM,c_tptp_9_597,c_executionbyfiringsquad,c_tptpcol_14_31739)) ) )).

fof(ax3_5918,axiom,
    ( mtvisible(c_tptp_member2788_mt)
   => relationallexists(c_tptp_9_597,c_executionbyfiringsquad,c_tptpcol_14_31739) )).

% Cyc Assertion #2178810:
fof(ax3_5919,axiom,(
    genlmt(c_tptp_member1969_mt,c_basekb) )).

% Cyc Assertion #1299798:
fof(ax3_5920,axiom,(
    genlmt(c_wamt_evalinitial_p1,c_basekb) )).

% Cyc Assertion #1552050:
fof(ax3_5921,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbluewaterwebcomnewsletterssept05_doyle2asp)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1309426:
fof(ax3_5922,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnaaedulocationhtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1788772:
fof(ax3_5923,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsaramacomforumsshowthreadphpthreadid35479)),c_translation_26),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1227616:
fof(ax3_5924,axiom,(
    genlmt(c_nwutrafficabilitymt,c_basekb) )).

% Cyc Assertion #652241:
fof(ax3_5925,axiom,(
    genls(c_spandrelatgm,c_partiallytangible) )).

fof(ax3_5926,axiom,(
    ! [OBJ] :
      ( spandrelatgm(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #486884:
fof(ax3_5927,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www20sixcoukdancecommanderarchive20040915n61crtr29jarhtm)),c_translation_8),c_basekb) )).

% Cyc Assertion #1492622:
fof(ax3_5928,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_summarycentraltripodcomthecrucible2htm)),c_translation_13),c_machinelearningspindleheadmt) )).

% Cyc Assertion #690439:
fof(ax3_5929,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwucdmcucdavisedusurgeryresidencysurgical_criticalindexshtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1751498:
fof(ax3_5930,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_the_cruciblebiographyms)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2182506:
fof(ax3_5931,axiom,(
    genlmt(c_tptp_member2893_mt,c_basekb) )).

% Cyc Assertion #775988:
fof(ax3_5932,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfactmonstercomipkaa0761438html)),c_translation_7),c_machinelearningspindleheadmt) )).

% Cyc Assertion #876241:
fof(ax3_5933,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_nfn(c_hydroxideradical,n_1))
     => partiallytangible(OBJ) ) )).

fof(ax3_5934,axiom,(
    genls(f_nfn(c_hydroxideradical,n_1),c_partiallytangible) )).

fof(ax3_5935,axiom,(
    ! [OBJ] :
      ( nfnhydroxideradical1(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #142101:
fof(ax3_5936,axiom,(
    genlmt(c_islamiccalendarvocabularymt,c_calendarsmt) )).

% Cyc Assertion #671889:
fof(ax3_5937,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwsimonsayscomtitles0684810948authorhtml)),c_translation_2_3),c_basekb) )).

% Cyc Assertion #762601:
fof(ax3_5938,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_fixedstructurevocabularymt)
        & isa(OBJ,f_groupfn(c_tunnel)) )
     => partiallytangible(OBJ) ) )).

fof(ax3_5939,axiom,
    ( mtvisible(c_fixedstructurevocabularymt)
   => genls(f_groupfn(c_tunnel),c_partiallytangible) )).

fof(ax3_5940,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_fixedstructurevocabularymt)
        & groupfntunnel(OBJ) )
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #159200:
fof(ax3_5941,axiom,(
    genls(c_frenchcuisine,c_artifact) )).

fof(ax3_5942,axiom,(
    ! [OBJ] :
      ( frenchcuisine(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1365864:
fof(ax3_5943,axiom,(
    genlmt(f_contextofpcwfn(c_lordoftherings_trilogy),c_basekb) )).

% Cyc Assertion #1722977:
fof(ax3_5944,axiom,(
    arg2isa(c_num_genquantrelnto,c_setorcollection) )).

fof(ax3_5945,axiom,(
    ! [ARG1,ARG2,ARG3,ARG4] :
      ( num_genquantrelnto(ARG1,ARG2,ARG3,ARG4)
     => setorcollection(ARG2) ) )).

% Cyc Assertion #1058113:
fof(ax3_5946,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbacktothebibleorgradiotoday21459)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2470287:
fof(ax3_5947,axiom,(
    individual(c_georegion_l4_x77_y52) )).

% Cyc Assertion #2088991:
fof(ax3_5948,axiom,(
    genls(c_tptpcol_4_106497,c_tptpcol_3_98305) )).

fof(ax3_5949,axiom,(
    ! [OBJ] :
      ( tptpcol_4_106497(OBJ)
     => tptpcol_3_98305(OBJ) ) )).

% Cyc Assertion #2184715:
fof(ax3_5950,axiom,(
    genlmt(c_tptp_member3445_mt,c_tptp_spindleheadmt) )).

% Cyc Assertion #1366058:
fof(ax3_5951,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewageresellercomstoreapf4amazon_products_feedcgioperationitemlookupitemidb00005uo7f)),c_translation_33),c_basekb) )).

% Cyc Assertion #2492976:
fof(ax3_5952,axiom,
    ( mtvisible(c_tptpgeo_member3_mt)
   => geographicalsubregions(c_georegion_l3_x4_y13,c_georegion_l4_x13_y41) )).

% Cyc Assertion #2177750:
fof(ax3_5953,axiom,(
    genlmt(c_tptp_member1704_mt,c_basekb) )).

% Cyc Assertion #188080:
fof(ax3_5954,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwradfordreviewscomcgi_binrviewcgirmmode2typereviewnameamistad)),c_translation_24),c_basekb) )).

% Cyc Assertion #2180178:
fof(ax3_5955,axiom,(
    genlmt(c_tptp_member2311_mt,c_basekb) )).

% Cyc Assertion #401331:
fof(ax3_5956,axiom,(
    genls(c_cycorpstandingteam,c_individual) )).

fof(ax3_5957,axiom,(
    ! [OBJ] :
      ( cycorpstandingteam(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #998567:
fof(ax3_5958,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_xrysostomblogspotcom2005_09_01_xrysostom_archivehtml)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1465505:
fof(ax3_5959,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_propersubcollectionnamedfn_ternary(s_makeportionofswing,c_individual,s_341a8502_f4ed_11d9_9bea_0002b3a85b0b))
     => individual(OBJ) ) )).

fof(ax3_5960,axiom,(
    genls(f_propersubcollectionnamedfn_ternary(s_makeportionofswing,c_individual,s_341a8502_f4ed_11d9_9bea_0002b3a85b0b),c_individual) )).

fof(ax3_5961,axiom,(
    ! [OBJ] :
      ( propersubcollectionnamedfn_ternarymakeportionofswingindividual341a8502_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2329261:
fof(ax3_5962,axiom,(
    isa(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_839,f_subcollectionofwithrelationfromtypefn(c_unitvectorinterval,c_directionoftranslation_throughout,c_movement_translationevent)) )).

fof(ax3_5963,axiom,(
    subcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent(c_tptpnsubcollectionofwithrelationfromtypefnunitvectorintervaldirectionoftranslation_throughoutmovement_translationevent_839) )).

% Cyc Assertion #1504650:
fof(ax3_5964,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnippiescomarchives5html)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2483847:
fof(ax3_5965,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_4(c_georegion_l4_x72_y75) )).

% Cyc Assertion #672599:
fof(ax3_5966,axiom,(
    genls(c_cblbindingspecification,c_aspatialinformationstore) )).

fof(ax3_5967,axiom,(
    ! [OBJ] :
      ( cblbindingspecification(OBJ)
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #673062:
fof(ax3_5968,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwfirestreamnetviewtopicphpt14262side7998082faab8a2c158e4622e3556a55)),c_translation_32),c_basekb) )).

% Cyc Assertion #1366384:
fof(ax3_5969,axiom,(
    genls(c_contemporaryartifact,c_artifact) )).

fof(ax3_5970,axiom,(
    ! [OBJ] :
      ( contemporaryartifact(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1444855:
fof(ax3_5971,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoff_roadcom4x4webfordboggerbigdawghtml)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #859766:
fof(ax3_5972,axiom,(
    genlmt(f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1998))),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #436380:
fof(ax3_5973,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetlakecrater(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2172770:
fof(ax3_5974,axiom,(
    genlmt(c_tptp_member459_mt,c_basekb) )).

% Cyc Assertion #2176746:
fof(ax3_5975,axiom,(
    genlmt(c_tptp_member1453_mt,c_basekb) )).

% Cyc Assertion #421421:
fof(ax3_5976,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_newsbbccouk1hientertainmentshowbiz2987670stm)),c_translation_27),c_basekb) )).

% Cyc Assertion #557625:
fof(ax3_5977,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwamb_usafrresourcesfranceusfamericans3htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #905085:
fof(ax3_5978,axiom,
    ( mtvisible(c_uia_generalmilitary_demoenvironmentmt)
   => genls(c_terrainflatground,c_geographicalregion) )).

fof(ax3_5979,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_uia_generalmilitary_demoenvironmentmt)
        & terrainflatground(OBJ) )
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1766503:
fof(ax3_5980,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_citypapernetarticles2004_11_25naked2shtml)),c_translation_18),c_basekb) )).

% Cyc Assertion #1485194:
fof(ax3_5981,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_freepagesgenealogyrootswebcomehowetimeline1820html)),c_translation_30),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1112464:
fof(ax3_5982,axiom,
    ( mtvisible(c_cycnounlearnermt)
   => genls(c_subtext,c_aspatialinformationstore) )).

fof(ax3_5983,axiom,(
    ! [OBJ] :
      ( ( mtvisible(c_cycnounlearnermt)
        & subtext(OBJ) )
     => aspatialinformationstore(OBJ) ) )).

% Cyc Assertion #1158359:
fof(ax3_5984,axiom,(
    genlmt(c_caspianpipelineconsortiummt,c_basekb) )).

% Cyc Assertion #1056678:
fof(ax3_5985,axiom,(
    genls(c_newbugzillabugreport,c_individual) )).

fof(ax3_5986,axiom,(
    ! [OBJ] :
      ( newbugzillabugreport(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1762883:
fof(ax3_5987,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_umanitobacamanitoban2003_20040324ar_04html)),c_translation_33),c_basekb) )).

% Cyc Assertion #1157338:
fof(ax3_5988,axiom,(
    genls(c_civillaw,c_individual) )).

fof(ax3_5989,axiom,(
    ! [OBJ] :
      ( civillaw(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #331384:
fof(ax3_5990,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dvdverdictcomreviewsflashdancephp)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1654959:
fof(ax3_5991,axiom,(
    genls(c_drainagesystem,c_partiallytangible) )).

fof(ax3_5992,axiom,(
    ! [OBJ] :
      ( drainagesystem(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2181158:
fof(ax3_5993,axiom,(
    genlmt(c_tptp_member2556_mt,c_basekb) )).

% Cyc Assertion #860888:
fof(ax3_5994,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwoireachtas_debatesgovies0071s0071197112090007html)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #856085:
fof(ax3_5995,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwharrynilssoninfoindexphppagesearchsubactionsearchexpandnilssonpagesdetailpeter20lawford)),c_translation_32),c_machinelearningspindleheadmt) )).

% Cyc Assertion #775595:
fof(ax3_5996,axiom,(
    genlmt(c_lunartopographyvocabularymt,c_basekb) )).

% Cyc Assertion #669327:
fof(ax3_5997,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmortgages_expocomalbany_mortgagehtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2055713:
fof(ax3_5998,axiom,(
    genls(c_tptpcol_8_93187,c_tptpcol_7_93186) )).

fof(ax3_5999,axiom,(
    ! [OBJ] :
      ( tptpcol_8_93187(OBJ)
     => tptpcol_7_93186(OBJ) ) )).

% Cyc Assertion #1685741:
fof(ax3_6000,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc33477)),c_translation_19),c_machinelearningspindleheadmt) )).

% Cyc Assertion #612526:
fof(ax3_6001,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_producerfn_ptproducttype(c_hardwaretool))
     => individual(OBJ) ) )).

fof(ax3_6002,axiom,(
    genls(f_producerfn_ptproducttype(c_hardwaretool),c_individual) )).

fof(ax3_6003,axiom,(
    ! [OBJ] :
      ( producerfn_ptproducttypehardwaretool(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2175214:
fof(ax3_6004,axiom,(
    genlmt(c_tptp_member1070_mt,c_basekb) )).

% Cyc Assertion #574134:
fof(ax3_6005,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcolumbusalivecom200020000406music1html)),c_translation_22),c_basekb) )).

% Cyc Assertion #2515333:
fof(ax3_6006,axiom,
    ( mtvisible(c_tptpgeo_member5_mt)
   => borderson(c_georegion_l4_x56_y47,c_georegion_l4_x57_y47) )).

% Cyc Assertion #2172254:
fof(ax3_6007,axiom,(
    genlmt(c_tptp_member330_mt,c_basekb) )).

% Cyc Assertion #1683744:
fof(ax3_6008,axiom,(
    genlmt(c_snomedmappingmt,c_basekb) )).

% Cyc Assertion #1869403:
fof(ax3_6009,axiom,(
    genls(c_tptpcol_13_18664,c_tptpcol_12_18663) )).

fof(ax3_6010,axiom,(
    ! [OBJ] :
      ( tptpcol_13_18664(OBJ)
     => tptpcol_12_18663(OBJ) ) )).

% Cyc Assertion #2182994:
fof(ax3_6011,axiom,(
    genlmt(c_tptp_member3015_mt,c_basekb) )).

% Cyc Assertion #792478:
fof(ax3_6012,axiom,(
    genls(c_generativeweightlearning,c_individual) )).

fof(ax3_6013,axiom,(
    ! [OBJ] :
      ( generativeweightlearning(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1461084:
fof(ax3_6014,axiom,(
    genls(c_hpacchembiotank_transportable,c_partiallytangible) )).

fof(ax3_6015,axiom,(
    ! [OBJ] :
      ( hpacchembiotank_transportable(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #571737:
fof(ax3_6016,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetcopperbottomside(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #2186390:
fof(ax3_6017,axiom,(
    genlmt(c_tptp_member3864_mt,c_basekb) )).

% Cyc Assertion #1720695:
fof(ax3_6018,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_attempttoassassinatepresidenturibevelez,c_actiononobject,s_33f6f772_f4ed_11d9_9bea_0002b3a85b0b)))
     => individual(OBJ) ) )).

fof(ax3_6019,axiom,(
    genls(f_unsatisfactoryattempttofn(f_propersubcollectionnamedfn_ternary(s_attempttoassassinatepresidenturibevelez,c_actiononobject,s_33f6f772_f4ed_11d9_9bea_0002b3a85b0b)),c_individual) )).

fof(ax3_6020,axiom,(
    ! [OBJ] :
      ( unsatisfactoryattempttofnpropersubcollectionnamedfn_ternaryattempttoassassinatepresidenturibevelezactiononobject33f6f772_f4ed_11d9_9bea_0002b3a85b0b(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1472109:
fof(ax3_6021,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcathartonnetcgi_localauthorsyabbcgiboardarthurmilleractiondisplaynum1123452712)),c_translation_7),c_basekb) )).

% Cyc Assertion #1773962:
fof(ax3_6022,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_minute_by_minute_account),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #1401948:
fof(ax3_6023,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwnewageresellercomstoreapf4amazon_products_feedcgioperationitemlookupitemidb00005uo7f)),c_translation_32),c_basekb) )).

% Cyc Assertion #1027539:
fof(ax3_6024,axiom,(
    genls(c_workedsolutionstep,c_individual) )).

fof(ax3_6025,axiom,(
    ! [OBJ] :
      ( workedsolutionstep(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #1130172:
fof(ax3_6026,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(f_subcollectionofwithrelationfromfn(c_facility_generic,c_operatesfacilities,c_unitedstatesfederalgovernment),c_objectfoundinlocation,f_territoryfn(c_panama)))
     => spatialthing_nonsituational(OBJ) ) )).

fof(ax3_6027,axiom,(
    genls(f_subcollectionofwithrelationtofn(f_subcollectionofwithrelationfromfn(c_facility_generic,c_operatesfacilities,c_unitedstatesfederalgovernment),c_objectfoundinlocation,f_territoryfn(c_panama)),c_spatialthing_nonsituational) )).

fof(ax3_6028,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnsubcollectionofwithrelationfromfnfacility_genericoperatesfacilitiesunitedstatesfederalgovernmentobjectfoundinlocationterritoryfnpanama(OBJ)
     => spatialthing_nonsituational(OBJ) ) )).

% Cyc Assertion #692472:
fof(ax3_6029,axiom,(
    genlmt(c_uia_halochemistry_demoenvironmentmt,c_cycorpproductsmt) )).

% Cyc Assertion #2177150:
fof(ax3_6030,axiom,(
    genlmt(c_tptp_member1554_mt,c_basekb) )).

% Cyc Assertion #722732:
fof(ax3_6031,axiom,(
    genlmt(c_glf_concealmentone_mt,c_basekb) )).

% Cyc Assertion #1733222:
fof(ax3_6032,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_hempassagenseulf78alien4alien4f_news2htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1600958:
fof(ax3_6033,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcwrueduartscienglmarlinghardboiledothermediahtm)),c_translation_1),c_basekb) )).

% Cyc Assertion #1655929:
fof(ax3_6034,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),f_glassboxallotmentfn(s_b4427885_bd24_40fb_b1b3_45a58d9f443f),c_nooescape_theprogram),c_nooescapearchitecturemt) )).

% Cyc Assertion #486262:
fof(ax3_6035,axiom,(
    genlmt(c_interagentartifactvocabularymt,c_basekb) )).

% Cyc Assertion #1462441:
fof(ax3_6036,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbootlegbettycomindexphpp307)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1398296:
fof(ax3_6037,axiom,(
    ! [OBJ] :
      ( collectionintersectionfnthesetpartiallytangiblelinearobject(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1319486:
fof(ax3_6038,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmovienavigatororgdigitalragehtm)),c_translation_2),c_basekb) )).

% Cyc Assertion #2189224:
fof(ax3_6039,axiom,(
    ! [TERM] :
      ( ( mtvisible(c_cyclistsmt)
        & executionbyfiringsquad(TERM) )
     => tptp_9_720(TERM,f_relationallexistsfn(TERM,c_tptp_9_720,c_executionbyfiringsquad,c_tptpcol_15_32128)) ) )).

fof(ax3_6040,axiom,
    ( mtvisible(c_cyclistsmt)
   => relationallexists(c_tptp_9_720,c_executionbyfiringsquad,c_tptpcol_15_32128) )).

% Cyc Assertion #1443308:
fof(ax3_6041,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacomcgi_binresplkeywordbertlahroffset0)),c_translation_32),c_basekb) )).

% Cyc Assertion #245995:
fof(ax3_6042,axiom,(
    genlmt(c_mineralogymt,c_basekb) )).

% Cyc Assertion #723342:
fof(ax3_6043,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwiconsoffrightcomjt_12_05htm)),c_translation_2),c_basekb) )).

% Cyc Assertion #260685:
fof(ax3_6044,axiom,(
    genls(c_model_artifact,c_artifact) )).

fof(ax3_6045,axiom,(
    ! [OBJ] :
      ( model_artifact(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #1527935:
fof(ax3_6046,axiom,(
    genlmt(f_recordmtbyusertaskandapplicationfn(f_userofsystemwithlocalnamefn(c_glassboxenvironment01,s_janejones),f_glassboxallotmentfn(s_9c416432_b89a_4a1c_8796_12ce4f0f1626),c_nooescape_theprogram),c_nooescapearchitecturemt) )).

% Cyc Assertion #1531141:
fof(ax3_6047,axiom,(
    ! [OBJ] :
      ( collectionunionfnthesetoilrefinerynaturalgasprocessingplant(OBJ)
     => thing(OBJ) ) )).

% Cyc Assertion #784957:
fof(ax3_6048,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_evaluatingvalueofwithrespecttofn(c_firewall_network,c_missionspecificationmicrotheory))
     => individual(OBJ) ) )).

fof(ax3_6049,axiom,(
    genls(f_evaluatingvalueofwithrespecttofn(c_firewall_network,c_missionspecificationmicrotheory),c_individual) )).

fof(ax3_6050,axiom,(
    ! [OBJ] :
      ( evaluatingvalueofwithrespecttofnfirewall_networkmissionspecificationmicrotheory(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #2177622:
fof(ax3_6051,axiom,(
    genlmt(c_tptp_member1672_mt,c_basekb) )).

% Cyc Assertion #278641:
fof(ax3_6052,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtachtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #444351:
fof(ax3_6053,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_subcollectionofwithrelationtofn(c_modernmilitaryunit_deployable,c_institutionalfocus,c_russianperson))
     => partiallytangible(OBJ) ) )).

fof(ax3_6054,axiom,(
    genls(f_subcollectionofwithrelationtofn(c_modernmilitaryunit_deployable,c_institutionalfocus,c_russianperson),c_partiallytangible) )).

fof(ax3_6055,axiom,(
    ! [OBJ] :
      ( subcollectionofwithrelationtofnmodernmilitaryunit_deployableinstitutionalfocusrussianperson(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #2175550:
fof(ax3_6056,axiom,(
    genlmt(c_tptp_member1154_mt,c_basekb) )).

% Cyc Assertion #1521714:
fof(ax3_6057,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_12),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1706514:
fof(ax3_6058,axiom,(
    genlmt(c_cyclistsmt,c_calendarsmt) )).

% Cyc Assertion #1031298:
fof(ax3_6059,axiom,(
    genlmt(c_bridgehead_bundle_6,c_basekb) )).

% Cyc Assertion #1449619:
fof(ax3_6060,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1493011:
fof(ax3_6061,axiom,(
    genls(c_domesticatedanimalfood,c_artifact) )).

fof(ax3_6062,axiom,(
    ! [OBJ] :
      ( domesticatedanimalfood(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #2175662:
fof(ax3_6063,axiom,(
    genlmt(c_tptp_member1182_mt,c_basekb) )).

% Cyc Assertion #1094783:
fof(ax3_6064,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwstone_campbelljournalcomcurrentbookreviewsbreviewshtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #623523:
fof(ax3_6065,axiom,(
    genls(c_kb_chemical,c_partiallytangible) )).

fof(ax3_6066,axiom,(
    ! [OBJ] :
      ( kb_chemical(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1796765:
fof(ax3_6067,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_findarticlescomparticlesmi_hb4316is_200010ai_n15047749)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #527266:
fof(ax3_6068,axiom,(
    genls(c_bodyart,c_artifact) )).

fof(ax3_6069,axiom,(
    ! [OBJ] :
      ( bodyart(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #2180162:
fof(ax3_6070,axiom,(
    genlmt(c_tptp_member2307_mt,c_basekb) )).

% Cyc Assertion #503140:
fof(ax3_6071,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(f_groupfn(c_adultmalehuman)))
     => partiallytangible(OBJ) ) )).

fof(ax3_6072,axiom,(
    genls(f_groupfn(f_groupfn(c_adultmalehuman)),c_partiallytangible) )).

fof(ax3_6073,axiom,(
    ! [OBJ] :
      ( groupfngroupfnadultmalehuman(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1241631:
fof(ax3_6074,axiom,(
    genlmt(c_pq103_110mt,c_basekb) )).

% Cyc Assertion #2404976:
fof(ax3_6075,axiom,(
    individual(c_tptpnproductproviderfn_sellerelectronichouseholdappliance_9) )).

% Cyc Assertion #631647:
fof(ax3_6076,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmsuedudaggycopbkofdeadobits_sihtm)),c_translation_3),c_basekb) )).

% Cyc Assertion #1683709:
fof(ax3_6077,axiom,(
    individual(f_urlreferentfn(f_urlfn(s_http_clearwisdomnetemharticles20009258148html))) )).

% Cyc Assertion #1691939:
fof(ax3_6078,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_dodgsonucsdedulaselsal1973_1980html)),c_translation_11),c_machinelearningspindleheadmt) )).

% Cyc Assertion #983221:
fof(ax3_6079,axiom,(
    genlmt(c_us_gccsecurityrelationsmt,c_hpkbvocabmt) )).

% Cyc Assertion #1685812:
fof(ax3_6080,axiom,(
    genls(c_christianschool,c_partiallytangible) )).

fof(ax3_6081,axiom,(
    ! [OBJ] :
      ( christianschool(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #555851:
fof(ax3_6082,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmarxistsdemiddleastschoenmanprefhtm)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1716648:
fof(ax3_6083,axiom,(
    genlmt(f_contextofpcwfn(c_tkbfactentrysource_webpage_hezbollah__a_chapter_from_funding_evil),c_ldscdemonstrationspindleheadmt) )).

% Cyc Assertion #189853:
fof(ax3_6084,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_webamnestyorglibraryindexengasa160121999openofeng_2s3)),c_translation_2),c_basekb) )).

% Cyc Assertion #2173798:
fof(ax3_6085,axiom,(
    genlmt(c_tptp_member716_mt,c_basekb) )).

% Cyc Assertion #2180918:
fof(ax3_6086,axiom,(
    genlmt(c_tptp_member2496_mt,c_basekb) )).

% Cyc Assertion #577561:
fof(ax3_6087,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwciraorgukhowtofindushtml)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1051927:
fof(ax3_6088,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwinfopleasecomipeaa0761438html)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1615706:
fof(ax3_6089,axiom,(
    genlmt(c_charliecriterion2_infoconcriterionmt,c_basekb) )).

% Cyc Assertion #1620704:
fof(ax3_6090,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwgeorgiamonthlycomfestivaloftreeshtml)),c_translation_0_885),c_machinelearningspindleheadmt) )).

% Cyc Assertion #741221:
fof(ax3_6091,axiom,(
    genlmt(f_contextofpcwfn(f_editionforintervalfn(c_patternsofglobalterrorism_series,f_yearfn(n_1997))),c_miptdatabase19681997_termsmt) )).

% Cyc Assertion #1178156:
fof(ax3_6092,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_www2usenetarchiveorgdir100file477html)),c_translation_1),c_basekb) )).

% Cyc Assertion #1643131:
fof(ax3_6093,axiom,(
    genls(c_inanimateobject_nonnatural,c_inanimateobject) )).

fof(ax3_6094,axiom,(
    ! [OBJ] :
      ( inanimateobject_nonnatural(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #1215929:
fof(ax3_6095,axiom,(
    genlmt(c_testimonyofashifmohamedjumamt,c_basekb) )).

% Cyc Assertion #1191664:
fof(ax3_6096,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwprobertencyclopaediacommtehtm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #1021182:
fof(ax3_6097,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwcsecorgcsecsermonlengle_3833htm)),c_translation_0_885),c_basekb) )).

% Cyc Assertion #996579:
fof(ax3_6098,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_evaluatingvalueofwithrespecttofn(c_informationsystem,c_missionspecificationmicrotheory))
     => individual(OBJ) ) )).

fof(ax3_6099,axiom,(
    genls(f_evaluatingvalueofwithrespecttofn(c_informationsystem,c_missionspecificationmicrotheory),c_individual) )).

fof(ax3_6100,axiom,(
    ! [OBJ] :
      ( evaluatingvalueofwithrespecttofninformationsystemmissionspecificationmicrotheory(OBJ)
     => individual(OBJ) ) )).

% Cyc Assertion #542904:
fof(ax3_6101,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwindependent_bangladeshcomnewsjul0101072005mghtm)),c_translation_23),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1539656:
fof(ax3_6102,axiom,(
    genls(c_powder,c_inanimateobject) )).

fof(ax3_6103,axiom,(
    ! [OBJ] :
      ( powder(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #1453705:
fof(ax3_6104,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_explanation_guideinfomeaningmeasleshtml)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2173550:
fof(ax3_6105,axiom,(
    genlmt(c_tptp_member654_mt,c_basekb) )).

% Cyc Assertion #157433:
fof(ax3_6106,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_mtvshopmtvcomnamepageaspxpidp66596typevloc19221)),c_translation_0),c_basekb) )).

% Cyc Assertion #1761067:
fof(ax3_6107,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwbizmonthlycom1_20069shtml)),c_translation_14),c_basekb) )).

% Cyc Assertion #1346413:
fof(ax3_6108,axiom,(
    genls(c_gabapentin,c_partiallytangible) )).

fof(ax3_6109,axiom,(
    ! [OBJ] :
      ( gabapentin(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #894870:
fof(ax3_6110,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwiconsoffrightcomjt_12_05htm)),c_translation_3),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1686889:
fof(ax3_6111,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_jdlorgilabouthtm)),c_translation_0),c_machinelearningspindleheadmt) )).

% Cyc Assertion #335383:
fof(ax3_6112,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_storecoolstampscomendeavorsearchs_c332modestart80max20extcat)),c_translation_33),c_machinelearningspindleheadmt) )).

% Cyc Assertion #1677468:
fof(ax3_6113,axiom,(
    genls(c_exanimateobject,c_inanimateobject) )).

fof(ax3_6114,axiom,(
    ! [OBJ] :
      ( exanimateobject(OBJ)
     => inanimateobject(OBJ) ) )).

% Cyc Assertion #1411258:
fof(ax3_6115,axiom,(
    genlmt(c_testvocabularymt,c_basekb) )).

% Cyc Assertion #1194385:
fof(ax3_6116,axiom,(
    genlmt(f_contextofpcwfn(c_2001_aspaceodyssey_themovie),c_humansociallifemt) )).

% Cyc Assertion #1074241:
fof(ax3_6117,axiom,(
    genls(c_aspatialinformationstore,c_intangibleindividual) )).

fof(ax3_6118,axiom,(
    ! [OBJ] :
      ( aspatialinformationstore(OBJ)
     => intangibleindividual(OBJ) ) )).

% Cyc Assertion #630302:
fof(ax3_6119,axiom,(
    ! [OBJ] :
      ( isa(OBJ,f_groupfn(c_cigarette))
     => partiallytangible(OBJ) ) )).

fof(ax3_6120,axiom,(
    genls(f_groupfn(c_cigarette),c_partiallytangible) )).

fof(ax3_6121,axiom,(
    ! [OBJ] :
      ( groupfncigarette(OBJ)
     => partiallytangible(OBJ) ) )).

% Cyc Assertion #1485678:
fof(ax3_6122,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_wwwmtholyokeeduacadintrelpetroleumrandhtm)),c_translation_33),c_basekb) )).

% Cyc Assertion #2178986:
fof(ax3_6123,axiom,(
    genlmt(c_tptp_member2013_mt,c_basekb) )).

% Cyc Assertion #338673:
fof(ax3_6124,axiom,(
    genlmt(f_contentmtofcdafromeventfn(f_urlreferentfn(f_urlfn(s_http_reviewsauthorstorecom200504an_anonymous_auhtml)),c_translation_2),c_machinelearningspindleheadmt) )).

% Cyc Assertion #2477667:
fof(ax3_6125,axiom,
    ( mtvisible(c_worldgeographymt)
   => geolevel_3(c_georegion_l3_x16_y24) )).

% Cyc Assertion #1451091:
fof(ax3_6126,axiom,(
    genlmt(f_contentmtfn(c_ali_baba_linkattribute_ks),c_basekb) )).

% Cyc Assertion #2176002:
fof(ax3_6127,axiom,(
    genlmt(c_tptp_member1267_mt,c_basekb) )).

% Cyc Assertion #1698669:
fof(ax3_6128,axiom,(
    genls(c_minedarea,c_geographicalregion) )).

fof(ax3_6129,axiom,(
    ! [OBJ] :
      ( minedarea(OBJ)
     => geographicalregion(OBJ) ) )).

% Cyc Assertion #1478700:
fof(ax3_6130,axiom,(
    genlmt(c_definitionofworkmt,c_basekb) )).

% Cyc Assertion #367869:
fof(ax3_6131,axiom,(
    genls(c_pipe_conduitartifact,c_artifact) )).

fof(ax3_6132,axiom,(
    ! [OBJ] :
      ( pipe_conduitartifact(OBJ)
     => artifact(OBJ) ) )).

% Cyc Assertion #2175962: